KEGG   Mycobacterium sp. KMS: Mkms_1249Help
Entry
Mkms_1249         CDS       T00442                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mkms_1249 (deoA)
Enzymes [BR:mkm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mkms_1249 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1334389..1335735
Genome map
AA seq 448 aa AA seqDB search
MTDFTFDAPRPMSHLDAPTVIRVKRDGGDLPDEAIDWVIDAYTRGQVADEQMSALLMAIF
LRGMTGPEIARWTAAMVASGQRFDFTDLRRGGRPLALVDKHSTGGVGDKITIPLVPVVMA
CGGAVPQAAGRGLGHTGGTLDKLEAIPGFTAELTKSQIRQQLSEIGAAIFAAGELAPADR
KIYALRDVTATTESLPLIASSVMSKKIAEGARALVLDTKVGSGAFLPTEAEARELARTMV
ELGHAHGLVTRALLTDMSVPLGRAVGNAVEVVESLEVLAGGGPDDVVELTLALAAEMLDA
AGIDGTDPAETLRDGTAMDCFRALVAAQGGDTSRLAADALPIGVHTDTVTAPRGGTMGDI
DAMAVGLAVWRLGAGRSAPGEQVQFGAGLRIHRRPGEPVSAGEPLFTLYTDTPDRLGPAR
AELEGAWTVGDSAPPARPLIIDRITATG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacttcactttcgacgcgccccggccgatgtcgcatctcgatgctccgaccgtc
atccgggtcaaacgcgacggcggcgacctgcccgacgaggcgatcgactgggtgatcgac
gcgtacacccgcgggcaggtggccgacgagcagatgtcggccctgctgatggcgatcttc
ctgcgcgggatgaccggccccgagatcgcgcgctggacagcggcgatggtggcatcgggg
cagcggttcgacttcaccgatctgcgacgcggcggccgtccgctggcgctggtcgacaaa
cactccaccggcggggtcggcgacaagatcaccatcccgctggtgcctgtcgtgatggcc
tgcggcggcgcggtgccccaggccgccggacgcgggctcggccacaccggcggcaccctc
gacaaactcgaagccatccccggattcaccgccgaactgaccaaaagccagatccgccaa
caactcagcgagatcggtgcggcgatcttcgccgcgggtgagctggccccggccgaccgc
aagatctatgcgctgcgcgacgtcaccgccaccaccgaatcgctgccgctgatcgccagc
tcggtgatgagcaagaagatcgccgagggcgcccgcgcgctggtgctcgacacgaaggtc
ggttcgggcgccttcctgcccaccgaggccgaggcccgcgaactggcccgcacgatggtc
gagttgggtcacgcgcacggtctggtgacgcgcgccctgctgaccgacatgtcggtgccg
ctgggccgcgccgtcggcaacgcggtcgaggtcgtcgaatcgctggaggtgctcgccggc
ggcgggcccgacgacgtggtggaactgacgctggcgttggcggccgagatgctcgacgcc
gccgggatcgacgggaccgaccccgccgagacgctgcgcgacggtaccgccatggactgt
ttccgcgcgctcgtcgcggcccagggcggcgacacctcccgattggccgccgacgcgttg
cccatcggtgtccacaccgacaccgtcacggcaccgcgcggtggcaccatgggtgacatc
gacgcgatggcggtgggtctggcggtgtggcggctcggagcgggccgctcggcgcccggt
gagcaggtgcagttcggcgccggtctccgcatccaccgccgtcccggtgagccggtgagt
gcgggcgagccgctgttcaccctctacaccgacacccccgaccggctcgggccggcccga
gccgaactcgagggtgcctggacggtgggggacagtgccccgccggcgcgtccgctgatc
atcgaccggatcaccgcgacaggctga

DBGET integrated database retrieval system