KEGG   Mycobacterium sp. KMS: Mkms_1395Help
Entry
Mkms_1395         CDS       T00442                                 

Definition
muconolactone delta-isomerase (EC:5.3.3.4)
Orthology
K03464  
muconolactone D-isomerase [EC:5.3.3.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mkm01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mkm00362]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1498970..1499248
Genome map
AA seq 92 aa AA seqDB search
MLFHVRMDVRIPHDLDPQARIDLVSREKAYSQELQRAGKWPQIWRIAGEYSNFSVFDVES
NDELHELVSALPLFPYMDIHVTPLARHPSDVK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccacgtacgaatggacgtgcggatcccgcacgacctcgatccgcaggcgcgc
atcgacctggtctcccgcgagaaggcctattcccaggagttgcagcgagccgggaagtgg
ccgcagatctggcgcatcgccggtgagtactcaaacttctcggtcttcgacgtcgagtcg
aacgatgaactgcacgagctggtctcggctctgccgttgttcccctacatggacatccac
gtcacgccgctggcccggcacccctccgacgtcaaatga

DBGET integrated database retrieval system