KEGG   Mycobacterium sp. KMS: Mkms_1996Help
Entry
Mkms_1996         CDS       T00442                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mkm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2115384..2116274
Genome map
AA seq 296 aa AA seqDB search
MPELPEVEVVRRGLDAHVTGKAITAVRVHHPRAVRRHEAGPADLTARLLGMRITGTGRRG
KYLWLTLDDGDEPLARRAESSVALVVHLGMSGQMLLGPIPKEDHLRIAALFDDGTALSFV
DQRTFGGWLLADLVTVDGTDVPVPVAHVARDPLDPRFDRDAVVKVLRGKHSEIKRQLLDQ
TVVSGIGNIYADEALWRAKVNGARLAESLTKPKLAEILDHAADVMRDALGQGGTSFDSLY
VNVNGESGYFDRSLDAYGREGEPCRRCGAIMRRDKFMNRSSFYCPRCQPRPRVRRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactccccgaggtcgaggtcgtccggcgcggtctggacgcccacgtcaccggt
aaggcgatcaccgccgtgcgggtgcaccatccgcgggcggtgcgtcgccacgaagcgggg
cccgccgatctgacggcgcggctgctcggtatgcggatcaccggcaccggcaggcgcggc
aagtatctgtggctcaccctggacgacggcgatgagccgcttgcgcgaagagcggaaagc
agcgtggcgctggtggtgcacctcgggatgagcgggcagatgctgctcgggcccatcccg
aaagaggaccacctgcgcatcgccgcgctgttcgacgacgggaccgcgctgagcttcgtc
gaccagcggaccttcggcggctggctgctcgccgacctggtgaccgtcgacggcaccgac
gtgccggtgccggtcgcgcacgtcgcccgcgacccgctggatccgcggttcgaccgcgat
gcggtggtaaaggtgttgcgcggcaagcattccgagatcaaacgccagttgctcgaccag
accgtcgtatcggggatcggcaacatctacgccgacgaggcgctgtggcgggccaaggtc
aacggggcccggctggccgagtcgctgaccaagcccaagctcgccgagatcctcgaccac
gcggccgacgtcatgcgcgacgcgctcggacagggcggcacgtcgttcgactcgctctac
gtcaacgtcaacggcgaatccggatacttcgaccggtcgctggacgcctacggccgcgag
ggtgagccgtgccggcgctgcggggcgatcatgcgccgcgacaaattcatgaaccgctcg
tcgttctactgcccgcgctgccagccccgcccgcgggtgcgccgcgcctga

DBGET integrated database retrieval system