KEGG   Mycobacterium sp. KMS: Mkms_2101Help
Entry
Mkms_2101         CDS       T00442                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mkms_2101
Enzymes [BR:mkm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mkms_2101
Peptidases [BR:mkm01002]
 Cysteine Peptidases
  Family C44
   Mkms_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2223433..2225238)
Genome map
AA seq 601 aa AA seqDB search
MCGATGEVRLDGRTPDLAAVSAMAETLSPRGPDGAGAWSQGRVALGHRRLKIIDLSEAGA
QPMVDSDLGLAIAWNGCIYNYQQLRDELRGHGYSFFSTSDTEVLLKAYHHWGDRFVDRLY
GMFAFAIVERDSGRVLLGRDRLGIKPLYISEDAHRIRFASSLPALVAGGGVDTRIDPVAL
HHYLSFHSVVPPPLTILRGVKKVPPASLVAIEPDGRRTTTTYWTPDFTRHADRADWSEQD
WEDAMLTALRRAVERRLVSDVPVGCLLSGGVDSSLIVGLLAEAGQTGLQTFSIGFESVNG
VAGDEFKYSDIVAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEV
AKYVKVVQSGQGADEVFAGYHWYPPMAEPGAASVEGSVASYRAAFFDRDPAALGGLVTPP
YFADGDPSGRFVTEHFAREGAATGVDRALRLDTMVMLVDDPVKRVDNMTMAWGLEGRVPF
LDHELVELAATCPPEYKTAQGGKGVLKEAARRVIPAEVIDRPKGYFPVPALTHLEGPYLD
MVRDALSAPAAKERDLFRPEAVDRLLADPNGRLTPLRGNELWQMALLELWLQRHGITGPA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagccaccggcgaggtacgcctcgacggccgaacccctgacctagccgccgtc
tcggcgatggccgagacgttgtcaccgcgcggcccggacggcgcaggcgcctggtcgcag
ggccgggtcgcgctgggacaccgccgcctcaagatcatcgacctgtccgaggcgggcgcg
cagcccatggtcgactccgacctcggcctggccatcgcgtggaacggctgcatctacaac
tatcagcagctgcgtgacgaactccgcggccacggctacagcttcttctccaccagcgac
accgaggtgctgctcaaggcctaccaccactggggcgaccggttcgtcgaccgcctctac
gggatgttcgcgttcgcgatcgtcgaacgcgacagcggacgggttctgctcggccgcgac
cggctgggcatcaaaccgctctacatctccgaggacgcccaccggatccgcttcgcctcg
tcgttgcccgccctggtcgccggcggcggcgtggacacccgcatcgatccggtcgcgctg
caccactacctgtccttccactccgtcgtgccgccaccgctgacgatcctgcgcggtgtg
aagaaggtgccgccggcgtcgctggtcgccatcgaacccgacggcaggcgcaccaccacg
acgtactggaccccggacttcacccggcacgccgatcgcgccgactggtccgaacaggac
tgggaggacgcgatgctcaccgcgctgcggcgcgccgtcgagcgccggctggtctccgac
gtgccggtggggtgtctgctgtcgggcggcgtcgactcgagcttgatcgtgggcctgctc
gccgaggccggtcagaccgggctgcagaccttctcgatcggcttcgaatcggtcaacggc
gtggccggtgacgagttcaagtactccgacatcgtcgcgcagcggttcggcaccgaccac
caccagatccgcatcgacacggcgcggatgctgcccgccctcgacggtgcgatcggcgcg
atgagcgagccgatggtcagccacgactgcgtggccttctacctgctcagccaggaggtg
gccaagtacgtcaaggtggtgcagtcgggtcagggcgccgacgaggtgttcgccggctac
cactggtatccgccgatggccgaacccggcgccgcatcggtcgagggttcggtggccagc
taccgggcggcgttcttcgaccgcgacccggcggccctcggcgggctcgtcacgcccccg
tacttcgccgacggcgatcccagcggccggttcgtcaccgagcacttcgcccgcgagggc
gccgccaccggggtggaccgggcgctgcgcctcgacaccatggtcatgctcgtcgacgac
ccggtgaaacgcgtggacaacatgacgatggcctggggtctggagggccgcgtgccgttc
ctcgaccacgaactggttgaactggccgccacctgtccccccgagtacaagaccgcccag
ggcggtaagggcgtgctcaaggaggccgcgcgccgggtgatcccggccgaggtcatcgac
cggcccaaggggtacttcccggttcccgcgctcacccacctcgagggtccgtacctcgac
atggtccgcgacgccctgtcggcgccggccgccaaggaacgcgacctgttccggcccgag
gccgtcgaccggctgctggccgatccgaacggccggctcaccccgctgcgcggcaacgaa
ctgtggcagatggcgctgctggagctgtggctgcagcgacacgggatcaccggaccggcc
gcatga

DBGET integrated database retrieval system