KEGG   Mycobacterium sp. KMS: Mkms_2117Help
Entry
Mkms_2117         CDS       T00442                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mkm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2239728..2241596
Genome map
AA seq 622 aa AA seqDB search
MTAPATPTYPFSAIVGHDRLLLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAQILSRV
DGGALVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLV
DVLLDAAAMGRVHIERDGISHTHESRFVLIGTMNPEEGELRPQLLDRFGLTVDVAASRDV
DVRVEVIRARMAFEADPTGFADRHADLDAALARRVAEARALVPSVMLPDNELRRIAALCA
AFDVDGMRADLVVARTAVAHAAWRGELTVGEEDIRVAAELALPHRRRRDPFDDPGLDPQR
LDEAMEQAGESAETPDGDPDPEPPPDPPGGGVSGESPEPSRPQGNSSSAQTRSSGDPAAV
FKTRTLVVPGVGEGAPGRRSRARNRTGTVVAATADAGTGHGLHVFGTLLAAAENQRVPGR
PRPGVQDVRRSVREGQEGNLVVFVVDASGSMAARDRMAAVGGATLSLLRDAYQRRDKVAV
ITFRGREATLLLPPTTSVYIASRRLSRFDTGGKTPLAEGLLAARDVVVREKARDRARRCL
VVVLTDGRATGGPDPLGRTREAAARLVAEGAAAVVVDCETSFVRLGLAEELATALRAPAV
RLAHLRADDLTRLVTRTDRTAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcccgccacgccgacctatccgttcagcgccatcgtcggtcacgaccggtta
ctgctggcccttctgctgtgtgcggtgcggcccgagatcggcggcgtgctgatccgcggc
gagaagggcaccgcgaaatcgaccgccgtacgtgggctcgcgcagatcctgtcccgcgtc
gacggcggtgcgctcgtcgaactgccgatcggggccaccgaggaccgcgtcgtcggatcg
ctggacctgcagaaggtgcttcgcgacggtgagcacgccttctcaccgggcctgctcgcc
cgcgcccacggcggcgtgctgtacgtcgacgaggtcaacctgttgcacgaccacctggtc
gacgtgctcctcgatgcggccgcgatgggccgtgtgcacatcgaacgggacggcatctcg
cacacccacgagtctcgattcgtgctgatcggcacgatgaatcccgaagagggcgaactg
cgtccgcagctgctcgaccggttcgggctgaccgtcgacgtcgcggcgtcgcgtgacgtc
gatgtccgagtcgaggtgatccgcgcgcggatggcgttcgaggccgacccgaccggcttc
gccgaccggcacgccgacctggatgccgcactggcgcggcgggtcgccgaagcgcgcgcc
ctggtgccgtcggttatgttgccggacaacgagttacgacggattgcggcgttgtgcgcc
gcgttcgacgtggacgggatgcgggccgatctggtggtcgcgcgcaccgcggtggcgcac
gccgcgtggcggggggagctcaccgtcggcgaggaggacatccgggtggccgccgaactg
gcgctgccgcaccggcgcaggcgcgacccgttcgacgaccccggactggacccgcagcgc
ctcgacgaggcgatggagcaggccggtgagtccgccgagactcccgacggggaccccgac
cccgaaccaccgccggacccgccgggcgggggagtgtcgggcgaatcgccggaaccgtca
cggccacagggtaattcgtcgtcggcgcagactcgcagcagcggcgacccggccgcggtg
ttcaagaccaggacgctggtggtccccggtgtcggagagggggcacccggccgtcggtcg
cgcgcgcgcaatcgcaccggcaccgtcgtggcggccaccgccgacgccgggaccggccac
ggtttgcacgtcttcggcacgctgctggccgccgcggagaaccagcgggtcccgggccgg
ccccggccgggcgtgcaggacgtgcgccggtccgtgcgcgagggccaagaggggaacctg
gtggtcttcgtcgtcgacgcctcgggttcgatggcggcccgcgaccggatggccgcggtc
ggcggcgccacgctgtcgctgctgcgcgacgcctatcagcgccgggacaaggtcgcggtg
atcacgttccgcgggcgggaggccacgctgctgctgccacccacgacgtcggtgtacatc
gccagccgccggctgtcgcggttcgacaccggcggcaagacgccgctggccgaaggtctg
ctcgccgcccgcgacgtcgtcgtccgggagaaggcccgcgaccgcgcgcgccgctgtctg
gtcgtcgtgctgaccgacgggcgcgccaccgggggaccggatccgctcggccgcacccgc
gaggccgccgcccgcctggtggccgaaggggccgccgccgtggtcgtcgactgcgagacg
tcgttcgtgcggctgggtctggccgaggaactcgccacggcgctgcgcgcgcccgccgtc
cgcctggcgcacctgcgggccgacgatctcacccggctggtcacccggaccgaccgcacc
gccgcctaa

DBGET integrated database retrieval system