KEGG   Mycobacterium sp. KMS: Mkms_2232Help
Entry
Mkms_2232         CDS       T00442                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00520  Amino sugar and nucleotide sugar metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
Module
mkm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mkm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_2232
   00520 Amino sugar and nucleotide sugar metabolism
    Mkms_2232
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mkms_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABL91430
JGI: Mkms2232
UniProt: A1UF22
Position
complement(2345600..2346409)
Genome map
AA seq 269 aa AA seqDB search
MTATDSPVADPDAAGGDARRGFGIDVGGSGVKGGVVDLDTGQLIGERFKLPTPQPATPDA
VAKTIAAVVKEFGWTGKLGVTYPGVVTHGVVHTAANVDKSWLGVNAQEIYSAALDGQPVT
VLNDADAAGLAEERFGAGRDNTGVIVLLTFGTGIGSAVIHNGILLPNTEFGHLEVGGKEA
EHRAASSVKERKDWSYERWTQEVTKVLVAIENAIWPDLFIAGGGISRKADKWVPLLKNRT
PVVAAALQNSAGIVGAAMAAEVDVTATNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgattcgcccgtcgcagatccggacgccgccggtggggacgcgcgtcgc
ggattcggtatcgacgtcggcggcagcggcgtcaagggcggcgtcgtcgacctggacacc
ggtcaactgatcggcgagcggttcaaactccccaccccgcagcccgccacccccgacgcc
gtcgccaagaccatcgccgcggtggtcaaggagttcggctggaccggaaagctcggcgtc
acctatcccggcgtggtgacccacggggtcgtgcacaccgccgcgaacgtcgacaagtcg
tggctgggcgtcaacgcccaggagatctacagcgccgccctcgacggtcagccggtcacg
gtgctcaacgacgccgacgcggcggggctggccgaggagcgtttcggcgcgggccgcgac
aacaccggcgtcatcgtgttgctgaccttcggcaccggtatcggctcggcggtcatccac
aacggcatcctgctgcccaacaccgaattcggtcatctggaggtgggcggcaaggaagct
gagcaccgcgccgcgtcgtcggtcaaggagcgcaaggactggagttacgagcgctggacc
caggaggtcaccaaggtcctcgtggcgatcgagaacgcgatctggcccgacctgttcatc
gccggaggcggtatcagccgcaaggccgacaagtgggtgccgctgctgaagaaccgcacg
ccggtcgtggccgccgcgctgcagaactccgccggaatcgtcggcgcggcgatggccgct
gaggtggacgtcacagctaccaaccggtaa

DBGET integrated database retrieval system