KEGG   Mycobacterium sp. KMS: Mkms_2303Help
Entry
Mkms_2303         CDS       T00442                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mkm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2409875..2410834
Genome map
AA seq 319 aa AA seqDB search
MNLDNGRAIVGPADPQVQPRYAGWTTFARLPRLEDVSHADVVVVGVPFDSAVTYRPGARF
GPNAIRQGSRLIRGYNPELDVKPFEVCQFADAGDLACNPFDIAEAVDQVAEQLSQLLANG
TRAVILGGDHSVALPSLRAAHSVHGPMALVHFDAHLDTWDRYYGADITHGSPFRRAYEEG
LLLDRNMHVGVRGSIYDKQDLVDDANFGFSVVTCRDIGTLGAEGIVDKIRARVGDAPVYV
SVDIDVLDPAHAPGTGTPEAGGMTSRELLEVVRGLDSVNLVGVDVVEVSPAYDHAEITAI
AAANVTWEFLSVFGRKAQR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgacaacggccgcgcgatcgtcgggccggccgacccgcaggtgcagccccgt
tacgccggctggaccaccttcgcccggctgccacggctggaggacgtgtcccacgccgac
gtggtcgtggtgggtgtcccgttcgacagtgcggtcacctaccggccgggggcgcgcttc
ggccccaacgcgatacggcagggctcgcgcctgatccgcggctacaaccccgaactggac
gtcaaaccgttcgaggtctgccagttcgccgacgcgggggacctcgcatgcaatccgttc
gacatcgccgaggcggtcgaccaggtcgccgagcagttgagccaactgctcgccaacggc
acccgagcggtcatcctgggcggtgaccattcggtggcgctgccgtcgcttcgcgccgcc
cactccgtccacgggccgatggcgctggtgcacttcgatgcccacctcgacacctgggac
cgctactacggtgccgacatcacccacgggtcaccgttccggcgggcctacgaagaaggg
ctgctgctcgaccggaacatgcacgtcggggtccgcggatctatctacgacaaacaggat
ctcgtcgacgacgccaacttcggcttctccgtcgtcacctgccgcgacatcggcacgctg
ggcgccgagggcatcgtcgacaagatccgcgcccgcgtcggcgacgcgccggtctacgtc
tcggtcgacatcgacgtcctcgaccccgcccacgcgccgggtaccgggacgccggaggcc
ggcggcatgaccagccgcgaactgctcgaggtggtgcgcggtctggacagtgtgaacctg
gtcggcgtcgacgtcgtcgaggtctcacccgcctacgatcacgccgagatcaccgcgatc
gccgcggcgaacgtgacgtgggaattcctgtccgtcttcggaagaaaggctcaacgatga

DBGET integrated database retrieval system