KEGG   Mycobacterium sp. KMS: Mkms_2313Help
Entry
Mkms_2313         CDS       T00442                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mkms_2313
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mkms_2313
DNA repair and recombination proteins [BR:mkm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mkms_2313
    RecFOR pathway proteins
     Mkms_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2419324..2419914
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVIDIALDHAVIEAAGVGYKVMATPSTLATLRRGTESRLVTAMIVREDSMTLY
GFADADARDLFGTLLGVSGVGPKIALATLAVYDAPTLRQALADGDVTALTRVPGIGKRGA
ERMVLELRDKIGPVTTGAGVTAVGGHAVRGPVVEALVGLGFAAKQAEEACDKVLAADPDA
TTSSALRAALSMLGKK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtacgcggtgaggtgatcgacatcgcgctcgaccacgcggtgatcgaa
gccgccggggtgggctacaaggtgatggccaccccgtcgacgttggccacgctgcgccgc
ggcacggagtcgcgtctggtgaccgcgatgatcgtgcgcgaggattcgatgacgctgtac
gggttcgccgacgccgatgcgcgggacctgttcggcacgctgctcggcgtttccggggtg
gggccgaagatcgcgttggcgacgctggcggtctacgacgcgcccaccttgcgccaggcg
ctggccgacggcgacgtcaccgcgctcacccgggtgcccggtatcggcaagcgtggcgcc
gagcggatggtgctcgaactgcgcgacaagatcggcccggtcaccaccggggcgggtgtg
acggcggtcggtgggcacgccgtgcgcggcccggtggtcgaagcccttgtcgggctgggc
tttgcggccaaacaggccgaggaggcgtgtgacaaggtcctcgccgccgatccggacgcg
accacgtcgagcgcgctgcgggcggcgttgtcgatgctggggaagaagtga

DBGET integrated database retrieval system