KEGG   Mycobacterium sp. KMS: Mkms_2410Help
Entry
Mkms_2410         CDS       T00442                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00240  Pyrimidine metabolism
mkm00250  Alanine, aspartate and glutamate metabolism
mkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mkms_2410
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mkms_2410
Enzymes [BR:mkm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mkms_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Keratin
Motif
Other DBs
NCBI-ProteinID: ABL91608
JGI: Mkms2410
UniProt: A1UFK0
Position
2526202..2527152
Genome map
AA seq 316 aa AA seqDB search
MTRHLLTAADLSRDEATAILDDADRFSQALIGREVKKLPTLRGRTVITMFYENSTRTRVS
FEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGADALIIRHPASGAAQQLAEWT
AAEAGAPSVINAGDGTHEHPTQALLDALTLRQRLGGIEGRRVVIVGDVLHSRVARSNVLL
LHTLGAEVVLVAPPTLLPVGVRQWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFPSA
REYSVRYGLSDKRQALLPDSAVVLHPGPMLRGMEISSSVADSSQSAVLQQVSNGVHVRMA
VLFHLLVGAEQEAISA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagacatctgttgaccgcggccgacctgagccgcgacgaggccaccgcgatcctc
gacgacgccgaccggttcagccaggcgctgatcggccgcgaggtcaagaagctgccgacg
ctgcgcgggcgcacggtgatcacgatgttctacgagaacagcacccgcacccgggtctcg
ttcgaggtcgcgggcaagtggatgagtgccgacgtgatcaacgtcagcgcatccggttcc
tcggtggccaagggggagtcgttgcgcgacaccgcgctcacgttgcgcgccgcgggcgcc
gacgcgctgatcatccggcatcccgcctccggcgccgcccagcaactcgcggagtggacg
gccgccgaggcgggcgcccccagcgtgatcaacgccggcgacggcacccacgaacacccc
acccaggcgttgctcgacgctctgaccctgcgccagcggctcggcggcatcgagggcagg
cgggtggtgatcgtcggcgacgtactgcacagccgcgtggcccgatccaacgtgctgctc
ctgcacaccctgggcgcggaggtggtgctggtggcgccgccgaccctgctcccggtgggt
gtgcgccagtggccggtgaccgtgtcgcacgacctggacgccgaactgcccgccgccgac
gcggtgctcatgctgcgggtgcaggccgagcggatgaacggcgggttcttcccgtccgcg
cgcgagtactcggtgcgctacggcctgtccgacaagcgtcaggcactgctgcccgattcc
gcggtggtgctgcacccggggccgatgctgcgcggtatggagatctcctcgtcggtggcc
gactcgtcgcaatcggctgtgctgcaacaggtttccaatggtgtgcacgtccggatggcg
gtgctcttccatctgctcgtcggcgcggaacaggaggcgatcagcgcatga

DBGET integrated database retrieval system