KEGG   Mycobacterium sp. KMS: Mkms_2452Help
Entry
Mkms_2452         CDS       T00442                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00051  Fructose and mannose metabolism
mkm00562  Inositol phosphate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
mkm01230  Biosynthesis of amino acids
Module
mkm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mkm_M00002  Glycolysis, core module involving three-carbon compounds
mkm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_2452
   00051 Fructose and mannose metabolism
    Mkms_2452
   00562 Inositol phosphate metabolism
    Mkms_2452
Enzymes [BR:mkm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mkms_2452
Exosome [BR:mkm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mkms_2452
  Exosomal proteins of bladder cancer cells
   Mkms_2452
  Exosomal proteins of melanoma cells
   Mkms_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABL91649
JGI: Mkms2452
UniProt: A1UFP1
Position
2572848..2573633
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGHSERRTYHHEDDALVAAKAAA
AFRHGITPIVCIGEHLKVREAGNHVEHNVEQLRGSLAGLTSEQIGQAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGKLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgccttctcgctgccggacaagtacttcgacaaggtcgac
gtgacggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggggac
aaactgcgcctgagctacggcgcgcaggacgtttcgcagcacgattccggtgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgttcgttcgccgtcgtggggcac
tcggagcgccgcacctaccaccacgaggacgacgcgctggtggccgccaaggccgccgcg
gcgttccggcacggcatcaccccgatcgtctgcatcggtgagcacctgaaggtgcgtgag
gcgggcaaccacgtcgagcacaacgtcgagcagttgcgtggttcgctggcggggctgacg
tccgagcagatcggtcaggccgtcatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggcgccgccgacgcgcaggaggtgtgcaaggccatccgcgacgagctcggg
aagctctcctcaccgcagctggcggccgggatcagggtgctctacggcgggtcggtgaac
gccaagaacgtcggggagatcgtggcccaggaagacgtcgacggtgcgctggtcggtggg
gcctccctggacggtgagcagttcgccacgctgtcggcgatcgccgccggcgggcccctg
ccctga

DBGET integrated database retrieval system