KEGG   Mycobacterium sp. KMS: Mkms_2454Help
Entry
Mkms_2454         CDS       T00442                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_2454
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mkms_2454
  Energy metabolism
   00680 Methane metabolism
    Mkms_2454
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mkms_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2574171..2577011
Genome map
AA seq 946 aa AA seqDB search
MRRVRRTPILERMADLPEALEPIGSVTRTEVGREASEPMREDIRLLGAILGDTVREQNGE
DVFDLVERARVESFRVRRSEIDRAELAGLFDGIGVRAAIPVIRAFTHFALLANVAEDIHR
ERRRAVHVAAGEPPQDSSLAATYAKLDSAQLDSDEVSAALSGALVSPVITAHPTETRRRT
VFDTQHRITELMRLRAHGHETTDDGRDIELELRRHILTLWQTALIRLSRLKIQDEIETGL
RYYRAAFFEVIPRVNAEVRSALQTRWPDADLLAEPILRPGSWIGGDRDGNPNVTAEVVRQ
ATSRAAYTAFEHYFAELTGLEQELSMSARLVHVSDELAALADACHEAARADEPYRRALRV
IHGRLTATALEILDNQPEHELDLGLERYATPAELLADLDVIDASLRGHGSAVLADDRLLR
LREAVRVFGFHLSGLDMRQNSDVHEEVVAELLAWAGVHDDYASLPESDRIDLLVSELATR
RPLTSQKAELSELARKELDIVRAGARAVRVFGPQAVPNYIISMCESVSDMLEAAILLKEA
GLLDVSDDEPYAPVGIVPLFETIDDLQRGSSILEAALDLPLYRGMVTARGDSQEVMLGYS
DSNKDGGYLAANWALYRAELDLVESSRKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPG
AVNGSLRITEQGEVIAAKYAEPRIAHRNLETLVAATLESTLLDVEGLGDEAGPAYEVLDD
LAARAQRAYAELVHETPGFVDYFKASTPVSEIGALNIGSRPASRKPTTSISDLRAIPWVL
SWSQSRVMLPGWYGTGSAFEQYIAEGAAESEDRLGVLQDLYRRWPFFRTVLSNMAQVLAK
SDLGLAARYSELVEDEDLRRRVFDKIADEHERTIRMHRLITGQDDLLADNPALARSVFNR
FPYLEPLNHLQVELLRRYRSGEDDELVQRGILLTMSGLATALRNSG
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgggtccgccggacgccgatactggaacgcatggctgacctcccagaagcgctc
gaaccgatcggctcggtgacccggaccgaggtgggccgcgaagccagtgagccgatgcgc
gaagacatccggttgctgggcgccatcctgggtgacacggtccgcgagcagaacggtgag
gacgtgttcgacctcgtcgaacgcgcccgcgtggagtccttccgggtccgccgctccgag
atcgaccgggccgaactcgccggactgttcgacggtatcggggtgcgcgccgcgataccc
gtcatccgggcgttcacccatttcgcactgctggccaacgtggccgaggacatccaccgc
gagcgccgccgtgccgtgcacgtggccgccggtgaaccgccgcaggacagcagcctggca
gcgacgtacgccaaactcgattccgcacaactggattccgacgaggtgtcggccgcgctg
agcggtgcgctggtgtcgccggtgatcaccgcccaccccaccgagacccgcaggcgcacg
gtgttcgacacccagcaccgcatcaccgagctcatgcggctgcgggcacacggtcacgag
accaccgacgacgggcgcgacatcgagctggaattgcgcaggcacatcctcacgctgtgg
cagacggcgttgatcaggctgtcgcgcttgaagatccaggacgagatcgagaccgggctg
cgctactaccgcgccgcgttcttcgaggtcatcccacgcgtcaacgccgaggtccgctcc
gcactgcagacccggtggcctgacgcggacctgctggcagaaccgatcctgaggcccggc
tcctggatcggcggcgaccgtgacggcaatcccaacgtcaccgcggaggtggtgcggcag
gccacttcccgcgccgcctacacggccttcgagcactatttcgccgagctgaccgggctg
gagcaggaactgtcgatgtccgcgcggttggtgcacgtgagcgacgaactcgccgcactg
gccgatgcctgtcacgaggccgcccgggccgacgaaccgtaccggcgcgcgctgcgggtg
atccacggcaggctcaccgccaccgccctggagattctcgacaaccagcccgaacacgaa
ctcgacctcggcctggagcgctacgccacgccggccgagctgctcgccgacctcgacgtc
atcgatgcgtcgctgcggggccacggcagcgccgtactcgccgacgaccggttgctacgc
ctgcgagaagcggtgcgagtcttcggtttccacctgtccggcctggacatgcggcagaac
tccgacgtccacgaggaggtcgtggcggaactgctggcgtgggcgggtgtgcacgacgac
tacgcctcgctgccagagtcggaccgtatcgacctgctggtctctgagctggccacccgt
cgcccgctcacctcccagaaggccgaactgtcggaactggcacgaaaagaactcgacatc
gtccgggccggggcgcgtgcggtgcgggtgttcggcccgcaggcggtgcccaactacatc
atctcgatgtgtgagtcggtgtcggacatgctcgaagcggccatcctgctcaaagaggcc
ggcctgctcgacgtctcggatgacgaaccgtacgccccggtcggcatcgtcccgctgttc
gagacgatcgacgacctacagcgcggatcgtcgatcctcgaagcggcccttgaccttccg
ctgtaccgcggcatggtcaccgcacgcggtgacagccaggaggtcatgctcggctactcc
gactccaacaaggacggcggctatctcgccgcgaactgggcgctctaccgggccgaactc
gacctggtcgaatcgtcccgcaagaccggtatccggttgcggctcttccacggacgcggc
ggcaccgtcggccgcggtggtggaccgagctacgacgcgatcctcgcgcaaccgccaggc
gcggtgaacggttcgctgcgcatcaccgaacagggtgaggtgatcgccgccaagtacgcc
gaaccgcggatcgcgcaccgcaacctcgagacgctggtggccgcgacgctggaatcgacg
ctgctcgacgtcgaggggttgggggacgaggccgggccggcttacgaggtactcgacgat
ctcgcggccagggcgcagcgggcatacgccgaactggtccacgagacaccgggattcgtc
gactacttcaaggcgtccaccccggtgagcgagatcggggcgctcaacatcggcagcagg
ccggcctcacgcaagccgacgacgtccatctccgatctgcgggccatcccgtgggtgctg
tcgtggagccagtcccgggtcatgctgcccggctggtacggcaccggcagcgccttcgag
cagtacatcgccgaaggggcggccgaatccgaggaccggctgggggtgctgcaggacctc
taccggcggtggccgttcttccgcaccgtgctgtccaacatggcgcaggtgctggcgaag
tcggatctcggtctggccgcgcggtattcggagctcgtcgaggacgaggacctgcggcgc
cgtgtattcgacaagatcgccgacgaacacgagcgcaccatccggatgcacaggctgatc
accggtcaggacgatctgctggccgacaacccggcgctggcccgctcggtgttcaaccgg
ttcccgtatctcgaaccgctcaaccatctacaggtcgaactcctgcgccggtaccggtcg
ggggaggacgacgaactggtgcagcgcgggatcctgctcacgatgagcgggctcgcgacg
gcgctgcgcaacagcggttag

DBGET integrated database retrieval system