KEGG   Mycobacterium sp. KMS: Mkms_2635Help
Entry
Mkms_2635         CDS       T00442                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mkms_2635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mkms_2635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mkms_2635
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mkms_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2766275..2767576
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVEVPTHWYNLAAELGEPIPPHLHPGTKEPVGPDDLAPLFASGLIAQ
EVATEIYIEIPQEVREIYTMWRPSPLIRARRFEKALNTSAHIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTEAGRAILAKDPNTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPNGADVVFGCAGGGSNLAGLSFPFLREKVHGRSNPRIVAAEPT
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQRDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagctcgacgccacccatccggacctcgtcaccgtcgaggtgccgacgcac
tggtacaacctggcggccgagctgggcgagccgatcccgccgcatctgcatcccggcacc
aaagaaccggtcggcccggatgacctcgcgccgctgttcgccagcgggttgatcgcgcag
gaggtggccaccgagatttacatcgagatcccgcaggaggtgcgggagatctacacgatg
tggcgtccgtccccgctgatccgcgcccggcgcttcgagaaggccctgaacaccagcgcc
cacatctacgtcaagtacgaaggtgtcagcccggtcggcagccacaagaccaactccgcg
gtggcacaggcgtactacaactccatcgacggcgtgcggaagctcaccaccgagaccggc
gccgggcagtggggaagtgccctgtcgttcgccggagcccagttcggactggaggtcgag
gtgtggcaggtccgcgcttcgtacgagtccaagccgtatcgggggcatctgatgcggacc
tacggcggcacggtgcactcgagcccgtcgacgctcaccgaggcgggccgcgccatcctg
gccaaggatccgaacaccaccggcagcctcggcatggcggtcagcgaggcggtcgaggtt
gccgcggccgacccggaggcccgctatgcgctgggcagcgtgctcaatcatgtggtgctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgttggtggagccgaacggc
gccgacgtcgtattcggttgcgccggaggcggttcgaacctcgccgggctgtcgtttccg
ttcctgcgggagaaggtccacggccggtcgaacccgcggatcgtggccgcagagccaact
gcgtgcccgtcgatcaccgagggtgagtaccgctacgaccatggcgacgtggccgggctc
accccgctgctcaagatgcacacgctgggtatggatttcgtgcccgacccgatccacgcc
ggcggactgcgctaccacggcatggcgccggcgctgagccacaccgtggagctgggtctg
gtcgagggcgtggcgatctcgcagcgcgacgcgttcgctgccggggtgcagttcgcgcga
acgcagggcatcgtgccggctccggagtcgacgcacgccatcgcggccgcggccgcacat
gtcgccgatgacccgcgcgagcaggtcgtggtgatcggactgtccgggcatggtcagctg
gatctgccggcctacgcggagtacctcgacggcaagctctga

DBGET integrated database retrieval system