KEGG   Mycobacterium sp. KMS: Mkms_2913Help
Entry
Mkms_2913         CDS       T00442                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00500  Starch and sucrose metabolism
mkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mkms_2913
Enzymes [BR:mkm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mkms_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABL92107
JGI: Mkms2913
UniProt: A1UGZ9
Position
3053747..3055906
Genome map
AA seq 719 aa AA seqDB search
MTELSPSLVELAARHGVATRYEDWSGTQVAVPESTLIAVLAALGVAAADDEQRAAALIQH
DRNYWQRSLPPTILARTGSTSSFWVHVTHGDPVEVWVALEDGSIRQSLHQLRNDTPPFDL
DGRLVGEASFELPADLPLGYHRVHMRTGTVEADAPLIVSPATLPVPPRLGARRSWGLATQ
LYSVRSHRSWGVGDLTDLTDLAVWSATRHGAGFILVNPLHAAAPAAPMEPSPYLPTSRRF
VNPLYLRPEAIPEYAELRHRGRLRRSRTEVQARARRRELIDRDSAWRAKRAALATIYRVE
RSAGRELAYAGYRAREGRALDDFAVWCALAEKYGNDWHGWPAELQHPRNVAVAAFAAEHA
DEVDFHRWLQWQLDEQLTAAHATAIGAGMDIGVMHDLAVGVNPDGADAWALQEVLALGVT
AGAPPDEFNQLGQDWSQPPWRPDQLVEQAYEPFRALVNGVLRHAGGVRIDHIIGLFRLWW
IPRGAAPTEGTYVRYDHEAMIGIVALEAHRTGAVVVGEDLGTVEPWVRDYLHDRGLFGTS
ILWFEQDRDGQDATGGPLPAERWREYCLSAVTTHDLPPTAGYLAGEHVRLRDELGLLTRP
AAEELADDRAAQAAWLAELRRVGLLAHPDNGEEPESDAVILALHRYLGRTPSKLLSLSLA
DAVGDLKTQNQPGTSDEYPNWRVPLRGPDGRQRLVEDVFTDPRAAALGAVMGSLVHPVL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgtccccgtcactggtcgaactcgccgcccgccacggcgtcgccacccgc
tacgaggactggtccggcacccaggtcgccgtgcccgagtcgacgctgatcgcggtgctc
gccgcactgggcgtcgccgcagcggacgacgagcaacgcgccgccgcgctcatacagcac
gaccgcaattactggcagcggtcactgccgcccacgatcctggcccgcaccggaagcacg
tcgtcgttctgggtgcacgtcacccacggtgacccggtcgaggtctgggtggccctggaa
gacgggtcgatccgccagagcctgcaccaattacgcaacgacacaccgcctttcgacctc
gacggccgactggtcggggaggccagcttcgagctgcccgccgatctgccgctgggttac
caccgggtgcacatgcggaccggaacggtcgaggccgatgcaccgctgatcgtctccccc
gccacgctgcccgtgccgccgcggctcggggcccggcgcagctgggggttggcgacccag
ctctacagcgttcgctcccaccgctcctggggtgtcggcgacctgacggatctgacggac
ctggcggtgtggtcggcgacgcggcacggcgccgggttcatcctggtcaaccccctgcac
gcggccgcgcctgccgcgccgatggagccgtcgccgtacctgcccacctcgcgacggttc
gtcaacccgctgtacctacggccggaggcgatccccgagtacgccgaactccgccatcgg
ggtcggttgcgcaggtcgcggaccgaggttcaggcccgtgcccggcgcagggagctcatc
gatcgcgattccgcctggcgggccaaacgggcggccctggcgaccatctaccgtgtcgaa
cgttcggccggccgtgagctcgcctacgccgggtaccgggcgcgggagggccgcgcgctc
gacgatttcgccgtgtggtgcgcgttggccgagaagtacggcaacgactggcacggctgg
cccgccgaactgcagcatccccgcaacgtggcggtggccgcgttcgccgccgagcacgcc
gacgaggtggacttccaccggtggctgcagtggcagctcgacgagcagctcaccgccgcg
cacgccacggcgatcggcgcggggatggacatcggggtcatgcacgacctcgcggtcggg
gtgaatcccgacggggccgacgcgtgggcactgcaggaggtcctggccctcggcgtcacc
gcgggcgcgccgcccgacgagttcaaccagctcggccaggactggtcgcagccgccgtgg
cgacccgaccagctcgtcgagcaggcctacgaaccgttccgggcgttggtcaacggggtg
ctgcggcacgcgggcggtgtccggatcgaccacatcatcggactgttccggctgtggtgg
atcccccggggcgccgcaccgaccgagggcacctatgtccgctacgaccacgaggcgatg
atcggcatcgtcgcgctcgaggcgcaccgtacgggggcggtcgtggtcggtgaggatctc
ggcaccgtcgaaccctgggtgcgcgactacctgcacgaccgcggactgttcggcacctcg
atcctgtggttcgaacaggaccgcgacggccaggacgccacaggtggtccgctccccgcc
gagcggtggcgggagtactgcctctcggcggtgaccacccatgatctgccgccgacggcc
ggttacctcgccggtgaacacgtccggttgcgcgacgaactcggactgcttacccgcccg
gcggccgaggaactcgccgacgaccgggcggcgcaggccgcgtggctggccgaactgcgc
cgggtcggcctgttggcccacccggacaacggcgaggaaccggagtccgatgccgtgatc
ctcgccctgcaccggtatctgggccggaccccgtcgaagctgctgtcgctgtccctggcc
gacgccgtcggcgatctgaagacccagaaccagccgggaacgagtgacgagtaccccaac
tggcgggtgccgctgcggggtccggacgggcgccagcgcctggtcgaggacgtgttcacc
gacccgcgggccgcggcgctcggcgccgtgatgggttcgttggtgcacccggtcctgtga

DBGET integrated database retrieval system