KEGG   Mycobacterium sp. KMS: Mkms_3110Help
Entry
Mkms_3110         CDS       T00442                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01130  Biosynthesis of antibiotics
mkm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mkms_3110
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mkms_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE His_biosynth OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABL92304
JGI: Mkms3110
UniProt: A1UHJ6
Position
complement(3257091..3257909)
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSIIEGVRADVAAREAVVSLTEIKERAQRAKPPLDVMAALREPGIGVIAEVKR
ASPSRGALAQIGDPADLARAYQDGGARVISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADMLLLIVAALEQPVLESLLERTESLGMTALVEVHTEAEADRALQ
AGARVIGVNARNLKTLEVDRDCFARIAPGLPSNVIRIAESGVRGPADLLAYAGAGADAVL
VGEGLVTSRDPRSAVADLVTAGTHPSCPKPSR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgaccgtgctcgactccatcatcgagggagtccgcgccgacgttgccgct
cgagaggccgtggtcagcctcaccgagatcaaggaacgggcgcagcgcgcgaagcctcca
ctggacgtgatggccgccctgcgcgaacccggcatcggggtcatcgccgaggtcaagcgg
gccagtccgtcccggggggcgctcgcccagatcggggatcccgccgacctggcccgcgcc
tatcaggacggcggcgcccgcgtgatcagcgtgctgaccgaacagcgccggttcaacggt
tcgctcgacgacctcgacgcagtccgcgcggcggtgtcgatcccggtcctgcggaaggac
ttcatcgtccggccgtatcagatccacgaagcccgcgcccacggtgccgacatgttgctg
ctcatcgtcgccgcactcgaacagcccgtgctcgagtcgttgctggagcgcaccgagtcg
ctcgggatgacggcgctggtggaggtccacaccgaagccgaagccgaccgcgcactgcag
gccggtgcccgggtgatcggcgtcaacgcgcggaatctcaagaccctcgaggtggaccgc
gactgcttcgcgcgcatcgccccgggactgccgtcgaatgtcatccgcatcgcggagtcc
ggcgtgcgcggccctgccgacctgctggcgtacgccggtgccggtgccgacgccgtgctc
gtcggcgaaggcctggtgaccagccgcgacccccgcagtgcggtggccgacctggtgacc
gccggaacccatccgtcctgcccgaaaccgtcccgatag

DBGET integrated database retrieval system