KEGG   Mycobacterium sp. KMS: Mkms_3183Help
Entry
Mkms_3183         CDS       T00442                                 

Definition
methylmalonyl-CoA mutase (EC:5.4.99.2)
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mkm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mkm00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mkm00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mkm00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3341655..3343937)
Genome map
AA seq 760 aa AA seqDB search
MTVNDVAGKPAPETTGIGSFADVPLHGEGAGAPATEAAVAAHIEAAAAAHGYTPEQLDWV
TPEGIDVKPVYVAADRAAAASAGYPLDSFPGAPPFLRGPYPTMYVNQPWTIRQYAGFSTA
AESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQGDVGMAGVAIDSILDMRQLFDG
IDLSTVSVSMTMNGAVLPILALYVVAAEEQRVPPEKLAGTIQNDILKEFMVRNTYIYPPK
ASMRIISDIFGYTSTKMPKFNSISISGYHIQEAGATADLELAYTLADGVEYIKAGLDAGL
SIDKFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAEFDPKNEKSLSLRTHSQTSGWS
LTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTDFSARIARNTQLLLQQESG
TTRPIDPWGGSYYVEWLTHQLATAARMHIGEVVAHGGMAQAISEGIPKLRIEEAAARTQA
RIDSGAQTVIGVNKYQVTEDHEIEVLKVENSRVRAEQLAKLQQLRADRDEDATRAALDEL
TRAAGAQGSAGEDGLGNNLLALAINAARAKATVGEISDALEKVYGRHVAEIRTISGVYRD
EAGKATNISSATELVEKFAEADGRRPRILVAKMGQDGHDRGQKVIATAFADIGFDVDVGS
LFSTPDEVAQQAADNDVHVVGVSSLAAGHLTLVPALRDALAAVGRPDIMVVVGGVIPPGD
FDELYAAGAAAIFPPGTVIADAATGLLHKLAERLGYDLNA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaacgatgtcgccggcaagccggctccggaaaccaccggcatcggcagcttc
gccgacgtaccgctgcacggtgaaggcgccggcgcacccgcgaccgaggccgccgtcgcc
gcacacatcgaggccgcggccgccgcgcacgggtacacccccgagcaactcgactgggtg
acgccggagggcatcgacgtcaaaccggtctacgtcgccgccgaccgcgccgccgccgcc
tcggccggatacccgctcgactcgttccctggcgcaccgccgttcctgcgcgggccgtac
ccgacgatgtacgtcaaccagccctggaccatccgccagtacgccggcttctcgaccgcc
gcggagtccaacgcgttctaccgccgcaacctggccgcgggccagaagggcctctcggtg
gccttcgacctggccacccaccgcggctacgactccgaccacccgcgggtgcagggcgat
gtgggcatggccggggtggccatcgactccatcctcgacatgcgccagctcttcgacggc
atcgacctgtcgacggtgtcggtgtcgatgaccatgaacggcgcggtgctgccgatcctg
gcgctctacgtcgtggccgccgaggagcagagggtgccgccggagaagctggcggggacc
atccagaacgacatcctcaaagagttcatggtccgcaacacctacatctatccgcccaag
gcgtcgatgcggatcatcagcgacatcttcggttacaccagcaccaagatgccgaagttc
aactcgatctcgatctccggctaccacatccaggaggccggggcgacggccgatctggag
ctggcctacacgctggccgacggcgtcgagtacatcaaggccggcctggacgccgggctc
tcgatcgacaagttcgcgccgcgactgtccttcttctggggcatcgggatgaacttcttc
atggaggtcgccaagctgcgcgccggccgactgctgtggagcgaactggtcgccgagttc
gacccgaagaacgagaagtcgctgtcgctgcgcacccactcgcagacctcgggctggtcg
ctgaccgcacaggacgtgttcaacaacgtcgcccgcacctgcatcgaggcgatggccgcc
acccaggggcacacgcagtcgctgcacacaaacgccctcgatgaggcgctcgcgctgccg
accgacttctcggcccgcatcgcgcgcaacacccagctgctgctgcagcaggagtccgga
accaccaggccgatcgacccatggggtgggtcgtactacgtcgagtggctgacccaccag
ctggccaccgccgctcggatgcacatcggtgaggtcgtcgcccacggcggaatggcgcag
gcgatcagcgagggcatcccgaagctgcgcatcgaggaggccgcggcccgcacccaggcc
cgtatcgactccggcgcgcagaccgtcatcggcgtcaacaagtaccaggtgaccgaggac
cacgagatcgaggtgctcaaggtcgagaacagccgggtgcgcgccgagcagctcgccaag
ctgcagcagttgcgcgccgaccgtgacgaggacgcgacccgcgccgcgctcgacgagctg
acccgggcggccggtgcgcaggggtcagccggggaggacgggctgggcaacaatctgttg
gcgctcgcgatcaacgccgcccgcgccaaggcgaccgtgggggagatctccgacgcactg
gagaaggtctacggccgccacgtcgccgagatccgcacgatctccggcgtctaccgcgac
gaagccgggaaggccaccaacatctcttccgcaaccgaactcgtggagaagttcgccgag
gccgacggccgccgaccccgcatcctggtcgccaagatggggcaggacggccacgaccgc
ggccagaaggtcatcgcgacggccttcgccgacatcggtttcgacgtcgatgtgggttcg
ttgttctccacgcccgacgaggtcgcccagcaggccgccgacaacgacgtgcacgtcgtc
ggtgtctcgtcgctggccgccggtcacctcacgctggtgcccgcgctgcgcgacgcgctg
gccgcggtcggcaggcccgacatcatggtggtggtcggcggggtcatcccgcccggcgac
ttcgacgagctctacgccgcaggggccgccgccatcttcccgccgggcaccgtgatcgcc
gacgccgcgaccgggctgctgcacaaactcgccgaacggctcggctacgacctgaacgcc
tga

DBGET integrated database retrieval system