KEGG   Mycobacterium sp. KMS: Mkms_3183Help
Entry
Mkms_3183         CDS       T00442                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00280  Valine, leucine and isoleucine degradation
mkm00630  Glyoxylate and dicarboxylate metabolism
mkm00640  Propanoate metabolism
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01200  Carbon metabolism
Module
mkm_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mkms_3183
   00640 Propanoate metabolism
    Mkms_3183
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mkms_3183
Enzymes [BR:mkm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Mkms_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase B12-binding DUF2866 Rotamase_2 Ca_hom_mod
Motif
Other DBs
NCBI-ProteinID: ABL92377
JGI: Mkms3183
UniProt: A1UHR9
Position
complement(3341655..3343937)
Genome map
AA seq 760 aa AA seqDB search
MTVNDVAGKPAPETTGIGSFADVPLHGEGAGAPATEAAVAAHIEAAAAAHGYTPEQLDWV
TPEGIDVKPVYVAADRAAAASAGYPLDSFPGAPPFLRGPYPTMYVNQPWTIRQYAGFSTA
AESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQGDVGMAGVAIDSILDMRQLFDG
IDLSTVSVSMTMNGAVLPILALYVVAAEEQRVPPEKLAGTIQNDILKEFMVRNTYIYPPK
ASMRIISDIFGYTSTKMPKFNSISISGYHIQEAGATADLELAYTLADGVEYIKAGLDAGL
SIDKFAPRLSFFWGIGMNFFMEVAKLRAGRLLWSELVAEFDPKNEKSLSLRTHSQTSGWS
LTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTDFSARIARNTQLLLQQESG
TTRPIDPWGGSYYVEWLTHQLATAARMHIGEVVAHGGMAQAISEGIPKLRIEEAAARTQA
RIDSGAQTVIGVNKYQVTEDHEIEVLKVENSRVRAEQLAKLQQLRADRDEDATRAALDEL
TRAAGAQGSAGEDGLGNNLLALAINAARAKATVGEISDALEKVYGRHVAEIRTISGVYRD
EAGKATNISSATELVEKFAEADGRRPRILVAKMGQDGHDRGQKVIATAFADIGFDVDVGS
LFSTPDEVAQQAADNDVHVVGVSSLAAGHLTLVPALRDALAAVGRPDIMVVVGGVIPPGD
FDELYAAGAAAIFPPGTVIADAATGLLHKLAERLGYDLNA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaacgatgtcgccggcaagccggctccggaaaccaccggcatcggcagcttc
gccgacgtaccgctgcacggtgaaggcgccggcgcacccgcgaccgaggccgccgtcgcc
gcacacatcgaggccgcggccgccgcgcacgggtacacccccgagcaactcgactgggtg
acgccggagggcatcgacgtcaaaccggtctacgtcgccgccgaccgcgccgccgccgcc
tcggccggatacccgctcgactcgttccctggcgcaccgccgttcctgcgcgggccgtac
ccgacgatgtacgtcaaccagccctggaccatccgccagtacgccggcttctcgaccgcc
gcggagtccaacgcgttctaccgccgcaacctggccgcgggccagaagggcctctcggtg
gccttcgacctggccacccaccgcggctacgactccgaccacccgcgggtgcagggcgat
gtgggcatggccggggtggccatcgactccatcctcgacatgcgccagctcttcgacggc
atcgacctgtcgacggtgtcggtgtcgatgaccatgaacggcgcggtgctgccgatcctg
gcgctctacgtcgtggccgccgaggagcagagggtgccgccggagaagctggcggggacc
atccagaacgacatcctcaaagagttcatggtccgcaacacctacatctatccgcccaag
gcgtcgatgcggatcatcagcgacatcttcggttacaccagcaccaagatgccgaagttc
aactcgatctcgatctccggctaccacatccaggaggccggggcgacggccgatctggag
ctggcctacacgctggccgacggcgtcgagtacatcaaggccggcctggacgccgggctc
tcgatcgacaagttcgcgccgcgactgtccttcttctggggcatcgggatgaacttcttc
atggaggtcgccaagctgcgcgccggccgactgctgtggagcgaactggtcgccgagttc
gacccgaagaacgagaagtcgctgtcgctgcgcacccactcgcagacctcgggctggtcg
ctgaccgcacaggacgtgttcaacaacgtcgcccgcacctgcatcgaggcgatggccgcc
acccaggggcacacgcagtcgctgcacacaaacgccctcgatgaggcgctcgcgctgccg
accgacttctcggcccgcatcgcgcgcaacacccagctgctgctgcagcaggagtccgga
accaccaggccgatcgacccatggggtgggtcgtactacgtcgagtggctgacccaccag
ctggccaccgccgctcggatgcacatcggtgaggtcgtcgcccacggcggaatggcgcag
gcgatcagcgagggcatcccgaagctgcgcatcgaggaggccgcggcccgcacccaggcc
cgtatcgactccggcgcgcagaccgtcatcggcgtcaacaagtaccaggtgaccgaggac
cacgagatcgaggtgctcaaggtcgagaacagccgggtgcgcgccgagcagctcgccaag
ctgcagcagttgcgcgccgaccgtgacgaggacgcgacccgcgccgcgctcgacgagctg
acccgggcggccggtgcgcaggggtcagccggggaggacgggctgggcaacaatctgttg
gcgctcgcgatcaacgccgcccgcgccaaggcgaccgtgggggagatctccgacgcactg
gagaaggtctacggccgccacgtcgccgagatccgcacgatctccggcgtctaccgcgac
gaagccgggaaggccaccaacatctcttccgcaaccgaactcgtggagaagttcgccgag
gccgacggccgccgaccccgcatcctggtcgccaagatggggcaggacggccacgaccgc
ggccagaaggtcatcgcgacggccttcgccgacatcggtttcgacgtcgatgtgggttcg
ttgttctccacgcccgacgaggtcgcccagcaggccgccgacaacgacgtgcacgtcgtc
ggtgtctcgtcgctggccgccggtcacctcacgctggtgcccgcgctgcgcgacgcgctg
gccgcggtcggcaggcccgacatcatggtggtggtcggcggggtcatcccgcccggcgac
ttcgacgagctctacgccgcaggggccgccgccatcttcccgccgggcaccgtgatcgcc
gacgccgcgaccgggctgctgcacaaactcgccgaacggctcggctacgacctgaacgcc
tga

DBGET integrated database retrieval system