KEGG   Mycobacterium sp. KMS: Mkms_3375Help
Entry
Mkms_3375         CDS       T00442                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_3375
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mkms_3375
  Amino acid metabolism
   00310 Lysine degradation
    Mkms_3375
Enzymes [BR:mkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mkms_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3538311..3540200
Genome map
AA seq 629 aa AA seqDB search
MGVTFDPIRLSRSRESQHMAVSVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTD
KVDTEIPSPASGVLQKIVAQEDDTVEVGGELAVIGEGGEDSGDSSDDSSSDEDEDEEPAE
EAESETTSEESDSSEETDSSEETESEPEPEPEPKKESKPKPKSSGSATPVTMPELGESVT
EGTVTRWLKKVGDSVEVDEPLLEVSTDKVDTEIPSPVAGTLLEIIAEEDDTVEVGGELAK
IGDADQAEAEEPEPEPEPEPEPEPEPEPEPEPKQESKPEPKPEPKQESKQEAKPEPKKEP
EPQQDAEPSDGSGPYVTPLVRKLAAEHDVDLAAVKGTGVGGRIRKQDVLAAAEADKKAKS
GPEDAAEAPGKAPAAATASANASDAPLAHLRGTKQKANRIRQLTAKKTRESLQATAQLTQ
THEVDMTKIVALRAKAKNDFAEREGVNLTYLPFIARAVIDALKQHPNVNASYNEDTKEIT
YYDAEHLGFAVDTDQGLLSPVIKNAGDLSLAGLARAIADIAARARSGDLKPDELSGGTFT
ITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDEFGNESIGVRSICYLPLTYDHR
LIDGADAGRFLTTIKRRLEEGSFEADLGL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgacattcgacccgatacgactgagccgttcgagggagtcacaacacatggcc
gtctctgttcagatgcccgcactcggtgagagcgtcaccgaaggcaccgtcacccggtgg
ctcaagcaagagggtgacacggtcgaacaggacgaacccctactcgaagtgtcgaccgac
aaggtcgacaccgagatcccgtccccggcctccggcgtgctgcagaagatcgtggcgcag
gaagacgacaccgtcgaggtcggcggggaactcgccgtgatcggcgagggcggcgaggat
tcgggcgactcctccgacgactcgtcttccgacgaggacgaggacgaggagcctgcggag
gaagcggagtcggagaccacctccgaggagtccgacagctccgaggagaccgacagctcc
gaagagaccgagagcgagccggaacccgaaccggagccgaagaaggagtcgaagccgaag
ccgaagtcctcgggttcggcgaccccggtgacgatgcccgagctgggtgagtccgtcacc
gagggcacggtcacccggtggctcaagaaggtcggcgacagcgtcgaggtcgacgaaccg
ctgctggaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcgggcacc
ctgctcgagatcatcgccgaggaggacgacacggtcgaggtcggcggggaactcgcgaag
atcggcgatgccgatcaggccgaggccgaagagcccgaaccggagccggaacccgagccg
gagccggagcccgaacccgaaccggaacccgagccgaagcaggagtccaagccggagccg
aagcccgagcccaaacaggagtccaagcaggaagccaagcccgagcccaagaaggagccc
gagccgcagcaggatgccgagccgtccgacggcagcggcccgtacgtcacgccgctggtg
cgcaaactggccgccgagcacgacgtggacctggccgccgtcaagggcaccggagtcggc
ggacgcatccgcaagcaggacgtcctggcggcggccgaggccgacaagaaggccaagtcc
ggccccgaggacgccgccgaggcacccgggaaggcgccggccgcggcgacggcatccgcg
aacgcctcggacgcaccgctggctcacctgcgcggcaccaagcagaaggccaaccggatc
cgtcagctgaccgcgaagaagacgcgcgaatccctgcaggcgacagcgcagttgacgcag
acccacgaggtcgacatgaccaagatcgtggcgttgcgggccaaggcgaaaaacgacttc
gccgagcgcgagggcgtcaacctgacctatctgccattcatcgccagggcggtcatcgac
gcgctcaaacagcatccgaacgtcaacgccagctacaacgaggacaccaaggagatcacc
tactacgacgccgagcacctcggcttcgcggtggacaccgatcagggtctgctctcgccg
gttatcaagaacgccggtgacctctcgctggccgggctggcccgcgcgatcgccgacatc
gccgcgcgtgcccgctccggtgacctcaaaccggacgaactgtccggcggcaccttcacg
atcaccaacatcggcagccagggcgccctgttcgacacgccgatcctggtgccgccgcag
gcggcgatgctgggcaccggtgcgatcgtcaaacggccgcgggtgatcgtcgacgagttc
ggcaacgagtcgatcggcgtgcggtcgatctgctacctgccgctgacctacgaccaccga
ctcatcgacggtgccgacgccggtcgcttcctgaccaccatcaagcgccgactcgaagag
ggttcgttcgaggcagacctgggtctgtaa

DBGET integrated database retrieval system