KEGG   Mycobacterium sp. KMS: Mkms_3475Help
Entry
Mkms_3475         CDS       T00442                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00030  Pentose phosphate pathway
mkm00051  Fructose and mannose metabolism
mkm00052  Galactose metabolism
mkm00680  Methane metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
mkm01230  Biosynthesis of amino acids
Module
mkm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_3475
   00030 Pentose phosphate pathway
    Mkms_3475
   00051 Fructose and mannose metabolism
    Mkms_3475
   00052 Galactose metabolism
    Mkms_3475
  Energy metabolism
   00680 Methane metabolism
    Mkms_3475
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mkms_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Peripla_BP_4 Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABL92669
JGI: Mkms3475
UniProt: A1UIL1
Position
3650333..3651307
Genome map
AA seq 324 aa AA seqDB search
MRRSGERTGHGPAIVTLTMNPALDITTSAPQVRPTSKIRCVGARYDPGGGGINVARTAHV
LGESVSAVFPVGGPTGDLVTELLGKADVPFRRIAIGDPTRESFTVNDDSSGQQYRFVLPG
PCLTAQEQAKCLEELRFEARAAQFVVASGSLPPGVPSDFYQRVADICRDVGARLILDTSG
DALQSVHSGVFLLKASVRELRERVGRDLLDRSDQLTAAQELIAAGVAEIIVVSLGSEGAL
LATSQGGHHFPPVPVEAVSGVGAGDAMVAAIAVGLTRGWSPTKSVQFGVATGAAMLLTPG
TEVCARADVERLFEATPEPEEIVG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagacggtccggcgaacgcacaggacacggaccggccatcgtcacgctgacgatgaac
ccggcgctcgacatcaccacgagcgcgccgcaggtccggccgaccagcaagatccgttgt
gtgggagcccgttacgaccctggaggcggtggcatcaacgtggcccgcaccgctcacgtc
ctcggcgagtcggtgtcggcggtgttccccgtgggcgggccgaccggcgacctggtcaca
gaactgctcggcaaggccgatgttccgttccgtcgtatcgcgatcggagatccgacgcgc
gagagcttcaccgtcaacgacgacagcagcggccagcagtaccggttcgtccttcccggc
ccctgtctgaccgcacaggaacaggcgaagtgtctggaggaactgcgtttcgaggcccgc
gcggcgcagttcgtggtggcaagtggcagcctgccgccgggcgttccctcggacttctac
cagcgggtcgccgacatctgccgcgacgtcggcgcacggctgatcctcgacacctcgggt
gacgccctccagagcgtccactcgggggtcttcctgctcaaagccagtgtgcgcgaacta
cgggagcgggtcggccgcgatctgctcgaccggtccgatcagctgaccgccgcacaggaa
ctcatcgccgccggcgtcgccgagatcatcgtggtgtccctgggttcggagggcgcgctg
ctggccacctcgcagggcggtcaccatttcccgccggtgcccgtggaggccgtcagtggt
gtcggcgcgggggacgcgatggtggcggcgatcgccgtcggcctgactcgcgggtggtcg
ccgaccaagtccgtgcagttcggggtcgccaccggagctgccatgttgttgacgccgggg
accgaggtgtgcgcacgagccgacgtggaacggctcttcgaagcgacgccggagcccgaa
gagattgtcggctaa

DBGET integrated database retrieval system