KEGG   Mycobacterium sp. KMS: Mkms_3612Help
Entry
Mkms_3612         CDS       T00442                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mkms_3612
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mkms_3612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3800143..3801000
Genome map
AA seq 285 aa AA seqDB search
MAAARVCVVGSVNADLRFAVPSLPRPGQTVLASSMTTSPGGKGGNQAIAAARAGGDVSLV
AALGDDPAAGQLRAHLRANGVGLDGVVTVPGPSGSAVVIVDAAAENAIVVAPGANAHLSV
ASSAVREAIAGADVVLLQLEIPLHTANDAARVARDAGAVVMVNASPAGAPPHELLRLSEV
ADVVVVNQAEAGEWHWPVPHLVITRGARGASYLGDGERFDVPAPAVEAVDTTGAGDVFAG
VLAVHWRSGHENALRRACVAGALATLVPGAGDCAPTAEAIDDTLR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgcgtgtctgcgtggtgggcagtgtgaacgccgatctgcgcttcgcggtg
ccgtcgctaccgcgccccggccagaccgtcctcgcgtcctcgatgacgacctcgcccggc
ggcaagggtggcaatcaggcgatcgccgcggcgcgggccggcggcgacgtctcgctggtg
gcagcactcggcgacgacccggcggccgggcagttgcgcgctcacctgcgcgcgaacggg
gtcggcctcgacggtgtggtgacggtgcccggccccagcggctcggccgtcgtgatcgtc
gacgccgccgcggagaacgccatcgtcgtcgcgcccggcgccaatgcgcacctgagcgtg
gcgtcgtcggcggtgcgtgaggcgatcgccggggcggacgtcgtgctcctgcaactcgag
atcccactgcatacggcgaacgacgcggcccgggtggcgcgcgatgcgggcgcggtggtg
atggtgaacgcctcccccgcgggcgcgccgccccacgagctgctgaggctgtccgaagtg
gccgacgtggtggtggtcaatcaggccgaggccggtgaatggcattggccggttccgcat
ctggtcatcacccgcggcgcccgcggggcgagctacctcggtgacggtgagcggttcgac
gtcccggcacccgcggtcgaggccgtcgacaccaccggcgccggtgacgtgttcgccgga
gtgctggccgtgcattggcggtccggacacgagaacgcgttgcgccgcgcgtgcgtcgcg
ggcgcgctggccaccctggtacccggcgcgggtgactgcgctcccaccgccgaagcgatc
gacgacacattgagatga

DBGET integrated database retrieval system