KEGG   Mycobacterium sp. KMS: Mkms_3620Help
Entry
Mkms_3620         CDS       T00442                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00330  Arginine and proline metabolism
mkm00332  Carbapenem biosynthesis
mkm01100  Metabolic pathways
mkm01130  Biosynthesis of antibiotics
mkm01230  Biosynthesis of amino acids
Module
mkm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mkms_3620
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mkms_3620
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mkms_3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABL92814
JGI: Mkms3620
UniProt: A1UJ06
Position
complement(3808862..3809995)
Genome map
AA seq 377 aa AA seqDB search
MTEAATRPSVHREAVRTARSVVVKIGTTALTTPTGVFDANRLATLVEAIEKRMKAGSDVV
IVSSGAIAAGIEPLRLSKRPTDLATKQAAASVGQVALINSWNTAFARYERTVGQVLLTAH
DISMRVQHTNAARTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALV
LLSDIDGLYDGDPRKAGPDNPARFIAEVNGADDLDGVVAGRGSHLGTGGMASKLSSALLA
ADAGVPVLLAAAADAATALSDASVGTVFAPRAERMSARRFWVRYAAESTGALTLDEGAVN
AVVRQRRSLLPAGITGVSGRFYGGDVVELRAPDATMVARGVVAYDATELATMLGRSTSDL
PADMRRPAVHADDLVAV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccgccacccgtccgtccgtgcaccgcgaggccgtccgcaccgcgcgcagt
gtcgtcgtcaagatcggcaccactgcgctgaccacgccgaccggcgtattcgacgccaac
cggctggccacgctggtcgaggcgatcgagaagcggatgaaggcgggctccgacgtcgtc
atcgtgtcgtccggcgccatcgcggccggtatcgaaccgttgcggctgtccaagcggccg
accgatctggccaccaaacaggccgccgccagcgtcgggcaggtcgcgctgatcaactcg
tggaacaccgccttcgcccggtatgagcgcaccgtcggacaggtgctgctcaccgcccac
gacatctcgatgcgcgtgcagcacaccaacgccgcccgcaccctcgaccggttgcgcgca
ctgcacgccgtggcgatcgtcaacgagaacgacacggtcgcgaccaacgagatccggttc
ggcgacaacgaccggctctcggcactggtggcgcatctggtgggggcggatgcgctcgtg
ctgctctccgatatcgacggcctctacgacggcgatccgcggaaagcgggcccggacaac
ccggcccgcttcatcgccgaggtcaacggagccgacgacctcgacggggtggtggccggg
cgcggcagccacctcggcaccggcggtatggcgtcgaagttgtcgtcggcgctgctggcc
gcagatgccggtgttccggtgctgctggccgccgccgccgacgctgccaccgcactgtcg
gatgcgtcggtcggcacggtgttcgcccctcgcgcggagcggatgtcggcgcggcgcttc
tgggtgcggtacgccgccgagtccacaggtgcgttgaccctcgacgagggtgcggtcaat
gccgttgtgcggcaacggcgttcgctgctgcccgcgggtatcaccggggtgtcgggacgg
ttctacggcggcgacgtcgtggagttgcgcgcacccgatgcgaccatggtcgcccgtggc
gtggtggcctacgacgcgaccgaactggccaccatgctgggccgttcgacgtcggaccta
cccgccgacatgcgcaggccggccgtccacgccgacgacctcgtcgccgtctga

DBGET integrated database retrieval system