KEGG   Mycobacterium sp. KMS: Mkms_3935Help
Entry
Mkms_3935         CDS       T00442                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mkm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4142569..4144848
Genome map
AA seq 759 aa AA seqDB search
MAKTKGLPKDTAVTPSPHLRPHTADLNRLLAGEHHDPHSILGAHEYDDHTVIRAYRPHAT
EVAAVVGGERHVFTHLEAGVFAVTLPFTGLIDYRLEVGYDHGGDQPHIHHTADAYRFLPT
LGEMDLHLFSEGRHERLWEVLGAHPRTFETPDGVVEGVSFAVWAPNANGVQLIGDFNHWD
GNEAQLRVLGSTGVWELFWPDFPVDGLYKFRIHGADGVVSERADPMAFATEVPPQTASRV
TTSSYTWNDDAWMTQRAAQNPVFEPMSTLEVHLMSWRPGLSYVELADQLTEYIVEHGFTH
VEMLPVAEHPFGGSWGYQVTSYYAPTSRLGTPDEFRYLVDRLHQAGIGVIVDWVPAHFPK
DAWALGRFDGTALYEHADPRRGEQLDWGTYVFDFGRAEVRNFLVANALYWLQEFHVDGLR
VDAVASMLYLDYSRPEGGWTPNIYGGRENLEAVQFLQEMNATVHKASPGIVTIAEESTSW
PGVTRPTNLGGLGFSMKWNMGWMNDTLAFISRDPIHRSYHHHEMTFSMLYAFSENYVLPI
SHDEVVHGKGTLWGRMLGDDHRKAAGVRQLLAYQWAHPGKQLLFQGQEFGQRAEWSEERG
VDWYQLDENSYSGGILRMISDMNGIYTSHRALWSHDTSPEGYSWIDANDSTNNVLSFLRY
GDDGSVLACVFNFSGSEHSQYRLGLPHAGTWREVLNTDAADYNGAGIGNYGAVQATDEPW
HGRPASAVMVLPPLSALWFEPVAAEAPVVQEPPTAPPLS
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaaaaggactgccgaaagacaccgcggtgacccccagcccgcatctgcgg
ccgcacaccgccgacctgaaccggttgctcgccggtgagcaccacgacccgcattcgatc
ctcggggcgcacgaatacgacgaccacacggtgatccgggcgtaccgtccgcacgcgacc
gaggtcgcggccgtcgtcggcggcgaacgccacgtgttcacccacctcgaggccggcgtg
ttcgcggtgacgctgccgttcaccggcctgatcgactaccgcctcgaggtcggctacgac
cacggcggcgaccagccgcacatccaccacaccgccgacgcgtaccggttcctgcccacg
ctgggcgagatggacctgcacctgttctccgaggggcgccacgaacggttgtgggaggtg
ctcggggcgcatccgcgcaccttcgaaacccccgacggcgtcgtcgaaggcgtctcgttc
gccgtctgggcgcccaacgccaacggtgtgcagctgatcggcgacttcaaccactgggac
ggcaacgaggcgcagctgcgcgtcctcggttcgaccggggtgtgggagctgttctggccg
gacttcccggtcgacgggctctacaagttccgcatccacggcgccgacggcgtggtgagc
gagcgggccgacccgatggccttcgcgaccgaggtgccgccgcagaccgcatcgcgggtc
accacgagcagctacacgtggaacgacgacgcgtggatgacgcagcgcgccgcccagaac
ccggtgttcgagccgatgagcaccctcgaggtgcacctcatgtcgtggcggcccggcctg
tcgtacgtggagttggccgatcagctgaccgagtacatcgtcgagcacgggttcacccat
gtcgagatgctgccggtggccgagcacccgttcgggggttcgtggggttaccaggtcacg
tcgtactacgcgccgacctcgcgcctgggcacccccgacgagttccgctacctcgtcgac
cgactgcaccaggccggcatcggggtgatcgtcgactgggtgcccgcgcacttcccgaag
gacgcgtgggcgctgggccggttcgacggcaccgcactctacgaacacgccgacccccgc
cgcggtgaacagttggactggggcacatacgtcttcgacttcggccgggccgaggtgcgc
aacttcctggtcgccaacgcgctgtactggctgcaggagttccacgtcgacggactacgc
gtggacgccgtcgcctcgatgctctacctggactactcgcggcccgagggcggctggacg
ccgaacatctacggcggccgcgagaacctcgaggcggtgcagttcctccaggagatgaac
gccaccgtgcacaaggccagtccgggcatcgtgacgatcgccgaggagtcgacgtcgtgg
cccggcgtgacccgtccgaccaatctgggcgggctgggcttctcgatgaagtggaacatg
ggctggatgaacgacacgttggcgttcatcagccgcgaccccatccaccgcagctaccac
caccacgagatgacgttctcgatgctctacgcgttcagcgagaactacgtgctgccgatc
agccacgacgaggtggtgcacggtaagggcacgctgtggggccggatgctcggcgacgac
caccgcaaggccgcgggcgtgcggcagctgctggcctaccagtgggcgcaccccggtaag
cagttgctgttccagggccaggagttcggccagcgcgcggagtggtcggaggagcggggc
gtcgactggtaccaactcgacgagaacagctactcgggcggcatcctgcggatgatctcc
gacatgaacgggatctacaccagccaccgggcgctgtggtcacacgacaccagcccggag
gggtactcgtggatcgacgccaacgactcgacgaacaacgtactgagcttcctgcgctac
ggcgacgacggttcggtgctggcgtgtgtgttcaacttctccggctccgagcacagccag
taccggctgggcctgccgcacgccgggacgtggcgtgaggtgctcaacaccgacgcggcc
gactacaacggcgcgggcatcggcaactacggggcggtgcaggccaccgacgagccgtgg
cacggccggcccgcctcggcggtgatggtgctgccgccgctgtcggcgctgtggttcgag
ccggtggccgccgaggcgcccgtcgtccaggagcccccgactgcgccgccgctgtcctga

DBGET integrated database retrieval system