KEGG   Mycobacterium sp. KMS: Mkms_3991Help
Entry
Mkms_3991         CDS       T00442                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mkm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4204992..4205720)
Genome map
AA seq 242 aa AA seqDB search
MNDHELAARLATRAGDLLLDVRAEFADTSAEERKAAGDKWSHDFLMAELNEQRPGDAVLS
EEGADDPVRLRSQRVWIVDPLDGTREFSELDRDDWAVHVALWQSGELVAGAVALPAQNTT
LATPDVAAPRPLDGPPRIVVSRTRPPAIALAVRDALGGTLVEMGSAGAKVASIMQGLSDV
YVHAGGQYEWDSAAPVAVARAAGLHCSRIDGSPLIYNREDPKLPDLVVCRPELAEAVLAV
TR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatcacgagctggccgcccggctcgccacccgggcgggcgacctgctgctcgac
gtacgtgcggagttcgccgacacctcggccgaggagcggaaagcggccggcgacaagtgg
tctcacgatttcctgatggccgaactcaacgagcaacggccgggtgacgcggtgctgtca
gaggaaggtgccgacgaccccgtgcggctgcgctcgcagcgggtgtggatcgtcgacccc
ctcgacggcacccgggagttctccgaactcgaccgcgacgactgggcggtccatgtggcg
ctgtggcagtccggtgaactggtggccggggcggtcgcgctgcccgcgcagaacaccacg
ctggccacccccgacgtcgccgcccccaggccgctcgacgggccaccgcggatcgtggtg
tcgcgcacccgcccacccgccatcgcgctcgcggtgcgtgacgcactcggtggcacgctc
gtcgaaatgggttcggccggagcgaaagtcgcctcgatcatgcaagggctctcggacgtc
tacgtgcacgcgggcggacagtacgagtgggattcggccgcgccggtcgcggtggcccgc
gccgccggactgcactgctcccgcatcgacggctcaccgctgatctacaaccgcgaggac
cccaagctgcccgatctggtggtgtgccgtccggaactggccgaggcggtgctggccgtc
acccgctga

DBGET integrated database retrieval system