KEGG   Mycobacterium sp. KMS: Mkms_4086Help
Entry
Mkms_4086         CDS       T00442                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00300  Lysine biosynthesis
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01230  Biosynthesis of amino acids
Module
mkm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mkms_4086
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mkms_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABL93278
JGI: Mkms4086
UniProt: A1UKC0
Position
complement(4312538..4313638)
Genome map
AA seq 366 aa AA seqDB search
MAPSSALRASGSSLDLRGDPVELTAALVDIPSESRHEQRIADEIEAALREQTDGFEIIRN
GDAVLARTNRGLPSRVLLAGHIDTVPAADNVPSRRVGDELHGCGTSDMKSGDAVFLHLAA
TVADPAHDLTLVMYDCEEIEASANGLGRIERELPEWLQADVAILGEPSGGFIEAGCQGTL
RVVVSATGTRAHSARSWLGDNAIHKLGAVLDRLAAYQARSIDIDGCVYREGLSAVRIDGG
IAGNVIPDAASVTVNFRFAPDRTVDQALAHVHEVLDGLDVTVEQTDAAAGALPGLTRPAA
AALVEAAGGQARAKYGWTDVARFAALGIPAVNYGPGDPNLAHRADERVDVGQITATTEVL
RRYLTA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccccatcatcggctcttcgcgcaagcggctcatcgctggatctccgtggtgacccg
gtcgagctgacggccgcactcgtcgacatccccagcgagtcgcgccacgagcagcgcatc
gccgacgagatcgaggccgcactgcgcgaacagacagacggtttcgagatcatccgcaac
ggcgacgcggtgctggcccgcaccaaccgggggctcccgtcacgcgtgctgctggccggg
cacatcgacaccgtgcccgccgccgacaacgtccccagccgccgggtcggtgacgagctg
cacggctgcggcacctccgacatgaagtccggggacgcggtgttcctgcacctcgccgcc
actgtcgccgaccccgcacacgacctcacgctggtgatgtacgactgcgaagagatcgag
gcgtcggccaacgggctcggccgcatcgaacgcgaactgcccgagtggctgcaggccgac
gtcgcgatcctcggcgaaccgtccggcggtttcatcgaggccggctgccagggcacgctg
cgagtcgtggtgagcgccaccggaacccgggcgcactccgcgcgatcctggttgggcgac
aacgccattcacaaactcggcgcggtcctcgaccggttggccgcctaccaggcccgcagc
atcgacatcgacggctgcgtctaccgcgagggactctccgcggtgcgcatcgacggcggc
atcgcgggcaacgtgatccccgacgccgcctcggtcaccgtcaacttccgcttcgccccc
gaccgcaccgtcgaccaggcgctggcccacgtccacgaggtcctcgacggactcgacgtc
accgtcgagcagaccgacgccgccgccggagccctgccggggctgaccaggccggcggcc
gcggcgctggtcgaggccgccggcggacaggcgcgggccaagtacgggtggaccgacgtg
gcgcggttcgcggcgctggggatcccggccgtcaattacggtccgggggatccgaacctc
gcccaccgcgcggacgaacgggtcgacgtcggccagatcaccgcgaccaccgaggtgctg
cgccggtatttaaccgcttga

DBGET integrated database retrieval system