KEGG   Mycobacterium sp. KMS: Mkms_4197Help
Entry
Mkms_4197         CDS       T00442                                 

Definition
(GenBank) fumarase
  KO
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mkms_4197
   00620 Pyruvate metabolism
    Mkms_4197
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Mkms_4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4423331..4424752
Genome map
AA seq 473 aa AA seqDB search
MTADSAVDQNTEYRIEHDTMGEVRVPKDALWRAQTQRAVENFPISGRGLERTQIRALGLL
KGACAQVNKDLGLLAPEKADAIIAAAAEIADGRHDDQFPIDVFQTGSGTSSNMNSNEVIA
SIAAANGVTVHPNDDVNMSQSSNDTFPTATHIAATEAAVRHLIPALEVLHESLAGKARQW
RTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELAIGGTAVGTGLNA
PDGFGAKVVEVLVDQTGLGELTTAKDSFEAQAARDGLVEASGALRVIAVSLTKIANDIRW
MGSGPLTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVAAQVVGNDAAVAWGGAAGAFE
LNVYIPMMARNLLESFKLLTNVSRLFAERCIDGLVANEEHMREQAESSPSIVTPLNSAIG
YEEAAKVAKEALKEKKTIRQTVIDRGLIGDKLSEEELDRRLDVLAMAKVKQGK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacagcgctgtcgaccagaacaccgagtaccgcatcgaacacgacaccatg
ggcgaggtccgggtgcccaaggatgcgctgtggcgggcgcagacccagcgcgccgtcgag
aacttcccgatctcgggccgcggcctcgagcgcacccagatccgcgcgctgggactgctc
aaaggcgcctgcgcgcaggtgaacaaggatctcggcctgctcgctcccgagaaggcggac
gcgatcatcgccgcggccgccgagatcgccgacgggcgtcacgacgaccagttcccgatc
gacgtgttccagaccggttcgggcaccagttcgaacatgaactccaacgaggtcatcgcc
tcgatcgcggcggcgaacggcgtgaccgtccaccccaacgacgacgtgaacatgtcgcag
agctccaacgacacgttcccgacggccacccacatcgcggcgacggaagccgctgtgcgc
cacctgatcccggcgctcgaggtgctgcacgaatcgctggccggcaaggcgcggcagtgg
cgcacggtcgtgaagtccgggcgcacgcacctgatggacgcggtgccggtgacgctgggc
caggagttcggcggttacgcccgtcagatcgaggccggtatcgagagggtcaaggcgacg
ctgccccggctgggtgagctggccatcggcggtaccgccgtcggcaccgggctcaacgcg
cccgacggcttcggcgccaaggtcgtcgaggtgctcgtcgaccagaccggtctgggcgaa
ttgaccacggccaaggactctttcgaggcgcaggccgcccgcgacgggctggtcgaggcg
tccggtgcgctgcgggtgatcgcggtgtcgctgaccaagatcgccaacgacatccgttgg
atgggttcgggcccgctgaccggcctggccgagatccagctgccggatctgcagccgggc
agctcgatcatgccgggcaaggtgaatcccgttctgcccgaagccgtcacgcaggtcgcc
gcccaggtcgtcggcaacgacgccgccgtcgcatggggtggcgcggccggcgcgttcgag
ctcaacgtgtacatcccgatgatggcgcgcaacctgctcgagtcgttcaagctgctgacc
aacgtgtcgcggctgttcgccgagcggtgcatcgacggcctggtcgccaacgaggagcac
atgcgcgagcaggccgagtcgtcgccgtcgatcgtgacgccgctgaactcggcgatcggc
tacgaggaggcggccaaggtcgccaaggaagcgctcaaggagaagaagacgatccgccag
acggtcatcgaccgcgggctgatcggcgacaagctctccgaggaggaactcgaccgtcgc
ctcgacgtgctggcgatggcgaaggtcaagcagggcaagtag

DBGET integrated database retrieval system