KEGG   Mycobacterium sp. KMS: Mkms_4376Help
Entry
Mkms_4376         CDS       T00442                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mkms_4376
   00052 Galactose metabolism
    Mkms_4376
   00500 Starch and sucrose metabolism
    Mkms_4376
   00520 Amino sugar and nucleotide sugar metabolism
    Mkms_4376
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mkms_4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4597236..4598147)
Genome map
AA seq 303 aa AA seqDB search
MSRPEVPIPYTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
ITSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVS
CVEPTLSDDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPPEKISAYGVFD
VEEVPDATNPNVLRVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALRRVKRGAGNEIQL
TDAIALLIEEGHPVHVVVHRGTRHDLGNPGGYLKAAVDFALERDDYGPELRQWLVERLGL
TEN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggccagaagtacccattccgtataccgctgtcgtgcccgccgcaggcctgggc
acgcgtttcctccccgccaccaagacggtgcccaaggaattgctgccggtcgtggacacc
cccgggatcgagttggtggccgccgaggccgcggaggcgggcgccgaacggctcgtcatc
atcacgtccgagggcaaggacggcgtggtcgcgcacttcgtcgaggacctggtgctcgag
gggacgctcgaggcccgcggtaagaagaccatgctcgagaaggtgcggcgcgcgcccgcg
ctgatcaaggtggaatcggtggttcaggccgaaccgctcggcctcggtcacgccgtcagc
tgcgtggagcccacgctgtccgacgacgaggatgcgatcgcggtgctgctgcccgacgac
ctcgtgctgccgaccggtgttctcgagacgatgtcgaaggtgcgcgcgaaacgcggcggt
tcggtgttgtgcgcgatcgaggtgccgcccgagaagatcagcgcctacggcgtattcgac
gtcgaagaggtgcccgacgccaccaaccccaacgtcctgcgcgtcaaggggatggtcgag
aaacccaaggccgaggatgccccgtcgccgtacgccgcggccggccgctacgtgttggac
cgagcgatcttcgacgcgctgcgacgtgtcaagcggggtgcgggcaacgagatccagctg
accgacgcgatcgcgctgctgatcgaggagggccatccggtgcacgtggtggtccaccgc
ggaacccgacacgacctgggaaatcccggcggctacctcaaggctgcggttgactttgcg
ttggaacgcgacgactacggccccgagctgcggcagtggttggtcgagcgattgggcctg
accgagaactag

DBGET integrated database retrieval system