KEGG   Mycobacterium sp. KMS: Mkms_4400Help
Entry
Mkms_4400         CDS       T00442                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mkm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4623892..4625277)
Genome map
AA seq 461 aa AA seqDB search
MVTQPHDLPRTVGELRASGHRERGVKQEIQENLLAGLAEGRDMWPGILGFEDTVIPQLER
ALIAGHDIVLLGERGQGKTRLLRALTGLLDEWTPVIEGSELGEHPYTPITPESIRRVADS
GDDLKVAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLQLDAEVGVITQEAQLAAAVPDHLLQILARFARNLRESSSVDQRS
GVSARFAIAAAETVAAAARHRSTILGEQEPVARVVDLGTVVDVLRGKLEFESGEEGREQV
VLEHLLRRATADTAQRLLGGLDVGPLVAAVEEGSPVTTGERVSAKDVLAALPDLPVIDAI
ATRLGAQTDGERAAAVELALEALYLAKRIDKVSGEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccaaccccatgatctgccccggaccgtcggcgaactacgcgcctccggccat
cgcgagcggggcgtcaaacaggaaatccaggagaacctgctggccggattggccgagggc
cgcgacatgtggcccgggatcctgggtttcgaggacacggtgatcccgcaactcgagcgg
gctttgatcgccggacacgacatcgtgctgctcggtgagcgcggccagggcaagacccgg
ctgctgcgcgcgctgaccggactgctcgacgagtggacacccgtcatcgaggggtcggaa
ctgggcgagcacccgtacaccccgatcacccccgaatccatccggcgggttgccgattcg
ggcgacgacctgaaggtggcctggcgccaccgcagcgagcggtacaccgagaaactcgcc
accccggacaccagcgtggccgacctggtcggcgacatcgacccgatcaaggtggccgag
ggccgcagcctcggcgacccggagaccatcgcctacggcctgatcccccgcgcacaccgc
ggcatcgtcgcggtcaacgagctgcccgacctcgccgagcgcatccaggtgtcgatgctc
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctcgac
gtcctcgtcgtcgccagcgcgaacccggaggactacaccaaccgcggtcgcatcatcacc
ccgctcaaggaccggttcggcgccgagatccgcacgcactatccgctgcagctcgacgcg
gaggtcggcgtcatcacccaggaggcgcagctcgcggcggccgtccccgaccacctgctg
cagatcctcgcccgcttcgcccgcaacctgcgcgaatcgagttcggtggatcagcgttcg
ggcgtctccgcgcggttcgcgatcgccgcggccgagaccgtcgccgcggccgcccggcac
cgctcgacgatcctcggggagcaggagccggtcgcccgcgtggtcgacctcggcaccgtc
gtcgacgtgctgcgcggcaagctcgagttcgaatccggtgaagaggggcgtgagcaggtg
gtgctcgagcacctgctgcgccgcgccaccgccgacaccgcgcagcggttgctcggtggt
ctcgacgtcgggccgctcgtcgcggcggtcgaggagggttccccggtgacgacgggtgaa
cgtgtgtccgccaaggacgtgctggccgcgctgccggacctgccggtgatcgacgcgatc
gccacccggctgggcgcgcagaccgacggtgaacgcgccgccgccgtcgaactggcgctc
gaggcgctgtacctggccaagcggatcgacaaggtctccggagagggcgaaaccgtctat
ggctga

DBGET integrated database retrieval system