KEGG   Mycobacterium sp. KMS: Mkms_4647Help
Entry
Mkms_4647         CDS       T00442                                 

Definition
oligopeptidase B (EC:3.4.21.83)
Orthology
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
mkm  Mycobacterium sp. KMS
Brite
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.83  oligopeptidase B
     Mkms_4647
Peptidases [BR:mkm01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Mkms_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4871845..4873965)
Genome map
AA seq 706 aa AA seqDB search
MTVPPPQAKRVEQRREHHGDVFIDPYEWLRDKSDPEVLAHLEAENAYTEAQTAHLAPLRQ
KIFDEIKARTKETDLSVPTRRGNWWYYGRSFEGKQYGVHCRCPVADPEDWTPPVLDENTT
IDGEQVLLDENVEAEGHEFFALGAATVSIDGNVLAYSVDTVGDERYTLRFKDLRTGEQYD
DTIVGIGAGATWAADNRTIYYSTVDDAWRPDTVWRHRLGAGLPAERVYHEPDERYWLGVG
RTRSDKYLIIAAGSAVTSEVRYADASDPEAEFAVVWPRRDGVEYSVEHAVVGGEDRFLIM
HNDGAENFALVDAPVADPGAARTLIEHREDVRLDAVDAFAGHLVLSYREEALPKIQLWPL
GADGSYGRAEDITFDTELTSAGLGGNPNWDAPKMRIAATSFVTPVRIYDLDLATGERTLL
REQPVLGGYRPEDYVERRDWAIAPDGARVPISIVHRAGLQFPAPTLLYGYGAYESCEDPR
FSIARLSLLDRGMVFAVAHVRGGGELGRPWYEQGKMLEKGNTFTDFIAVARHLIATDTTR
PQNLVALGGSAGGLLIGAVANLAPELFAGFLAQVPFVDPLTTILDPSLPLTVTEWDEWGN
PLEHEHVYHYMKSYSPYENVVAKDYPPILAMTSLNDTRVYYVEPAKWIAALRHTKTDGNP
VLLKTEMSAGHGGISGRYERWKEAAFQYAWVLATADPETYDNRSPN
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgccgcaggccaaacgggttgaacagcggcgcgaacaccacggcgac
gtgttcatcgacccctacgagtggctgcgcgacaaatccgatcccgaggtgcttgcccac
ctggaggccgagaacgcctacaccgaggcgcagaccgcgcatctcgcgccgttgcggcag
aagatcttcgacgagatcaaggcccgcaccaaggagaccgacctctcggtgcccacccgg
cgcggcaactggtggtactacgggcgcagcttcgagggtaagcagtacggcgtccactgc
cgttgccctgtcgcagatcccgaggactggacacctccggtgctcgacgagaacaccacc
atcgacggtgaacaggtcctgctcgacgagaacgtcgaagccgagggccacgagttcttc
gcgctcggggcggccaccgtcagcatcgacggcaacgtcctggcctactccgtcgacaca
gtgggcgacgagcggtacacactgcggttcaaagacctccgcaccggcgagcagtacgac
gacacgatcgtcgggatcggtgccggcgccacctgggccgccgacaaccgcaccatctac
tacagcaccgtcgacgacgcctggcggcccgacaccgtgtggcgccaccggttgggggcg
gggttgccggccgaacgggtgtaccacgaacccgacgaacggtactggctgggcgtcggc
cgcacccgcagcgacaagtacctgatcatcgccgcgggcagcgccgtcacctcggaggtg
cgctacgccgacgcgagtgatccggaggcggagttcgccgtggtgtggccgcgccgcgac
ggggtcgagtactccgtcgaacacgcggtggtcggcggggaggaccggttcctcatcatg
cacaacgacggtgcggagaacttcgcactcgtcgacgcgccggtggccgatccgggcgcg
gcccgcacgctcatcgaacaccgcgaggacgtgcgactcgacgcggtcgacgcgttcgcc
ggacacctcgtgctgagttaccgcgaagaggcactgcccaagatccaactgtggcccctg
ggcgccgacggatcatacggtcgcgccgaggacatcaccttcgacaccgaactgacctcg
gcggggctgggcggcaacccgaactgggacgcgccgaaaatgcgcatcgcggcaacgtct
ttcgtcaccccggtgcggatctacgacctcgacctcgcaacaggggagcgcacgctgctg
cgcgagcagccggtgctcggcggctaccggcccgaggactacgtcgagcgcagggactgg
gcgatcgccccggacggcgcgcgggtgcccatctcgatcgtccaccgtgccggccttcag
tttccggcaccgaccctgctctacggctacggcgcctacgagtcgtgtgaggacccacgg
ttctcgatcgcccggctctccctgctggaccgcggcatggtgttcgccgtcgcccacgtc
cgcggcggcggggaactcggccggccgtggtacgaacagggcaagatgctggagaagggc
aacaccttcaccgacttcatcgcggtggcaaggcatctcatcgccaccgacaccacgcgg
ccgcagaacctggtggcgctcggcggcagcgccggtgggttgttgatcggtgcggtcgcc
aacctggcgcccgaactgttcgccggcttcctggcacaggtgccgttcgtcgatccgttg
accactatcctcgacccgtcgctgccgctgacggtcaccgagtgggacgaatggggcaac
ccgctcgagcacgagcacgtctaccactacatgaagtcctactcgccgtacgagaacgtc
gtcgccaaggactatccgccgatcctggcgatgacctcgctcaacgacacccgtgtgtac
tacgtcgaaccggcgaaatggattgccgcccttcggcacacgaagaccgacgggaacccg
gtgctgctcaagaccgagatgagcgccggacacggcgggatcagcggacgctacgaacgg
tggaaggaagccgcgttccagtacgcctgggtgctcgcgaccgccgacccggagacctac
gacaaccgaagcccgaactag

DBGET integrated database retrieval system