KEGG   Mycobacterium sp. KMS: Mkms_4691Help
Entry
Mkms_4691         CDS       T00442                                 

Definition
2Fe-2S iron-sulfur cluster binding domain-containing protein
Orthology
K03518  
carbon-monoxide dehydrogenase small subunit [EC:1.2.99.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mkm01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mkm00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mkm00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4916432..4916926
Genome map
AA seq 164 aa AA seqDB search
MHELPVELTVNGRNHRGVVEPRITLADFLRETCGLTGTHLGCEHGACGACTVLLDGQAVR
SCLVFAVQADGQEVTTVEGIAGPDGELSPVQAAMKECHGLQCGFCTPGFVTSITALLADN
PDPSDEEIREGLSGNFCRCTGYQGIVNAVRLAAERTRNGQTVSP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagttgccggtcgagttgacggtcaacggccgcaaccatcgcggagtggtggag
ccgcgtatcacgttggccgacttcctgcgcgagacatgcggtctcaccggcacgcaccta
ggctgcgagcacggggcgtgcggtgcgtgcacggtgctgctcgacgggcaggcggtccgg
tcctgtctggtgttcgcggtgcaggccgacggccaggaggtcaccaccgtcgaaggcatc
gccggacccgacggtgagctctcccccgtgcaggccgcgatgaaggaatgccacggactc
caatgcggtttctgcacaccgggcttcgtcacctcgatcacggcgctgctggccgacaac
ccggatccgagcgacgaggagatccgcgaagggttgtcgggcaacttctgccgatgcacg
ggataccagggcatcgtcaacgccgtccgcctcgccgccgagcgcacgcgcaacgggcag
accgtaagcccgtag

DBGET integrated database retrieval system