KEGG   Mycobacterium sp. KMS: Mkms_4691Help
Entry
Mkms_4691         CDS       T00442                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K03518  aerobic carbon-monoxide dehydrogenase small subunit [EC:1.2.5.3]
Organism
mkm  Mycobacterium sp. KMS
Brite
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     Mkms_4691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Motif
Other DBs
NCBI-ProteinID: ABL93882
JGI: Mkms4691
UniProt: A1UM24
Position
4916432..4916926
Genome map
AA seq 164 aa AA seqDB search
MHELPVELTVNGRNHRGVVEPRITLADFLRETCGLTGTHLGCEHGACGACTVLLDGQAVR
SCLVFAVQADGQEVTTVEGIAGPDGELSPVQAAMKECHGLQCGFCTPGFVTSITALLADN
PDPSDEEIREGLSGNFCRCTGYQGIVNAVRLAAERTRNGQTVSP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagttgccggtcgagttgacggtcaacggccgcaaccatcgcggagtggtggag
ccgcgtatcacgttggccgacttcctgcgcgagacatgcggtctcaccggcacgcaccta
ggctgcgagcacggggcgtgcggtgcgtgcacggtgctgctcgacgggcaggcggtccgg
tcctgtctggtgttcgcggtgcaggccgacggccaggaggtcaccaccgtcgaaggcatc
gccggacccgacggtgagctctcccccgtgcaggccgcgatgaaggaatgccacggactc
caatgcggtttctgcacaccgggcttcgtcacctcgatcacggcgctgctggccgacaac
ccggatccgagcgacgaggagatccgcgaagggttgtcgggcaacttctgccgatgcacg
ggataccagggcatcgtcaacgccgtccgcctcgccgccgagcgcacgcgcaacgggcag
accgtaagcccgtag

DBGET integrated database retrieval system