KEGG   Mycobacterium sp. KMS: Mkms_4691Help
Entry
Mkms_4691         CDS       T00442                                 

Definition
2Fe-2S iron-sulfur cluster binding domain-containing protein
Orthology
K03518  
carbon-monoxide dehydrogenase small subunit [EC:1.2.99.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mkms_4691
  Energy metabolism
   00680 Methane metabolism
    Mkms_4691
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mkms_4691
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With other acceptors
    1.2.99.2  carbon-monoxide dehydrogenase (acceptor)
     Mkms_4691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4916432..4916926
Genome map
AA seq 164 aa AA seqDB search
MHELPVELTVNGRNHRGVVEPRITLADFLRETCGLTGTHLGCEHGACGACTVLLDGQAVR
SCLVFAVQADGQEVTTVEGIAGPDGELSPVQAAMKECHGLQCGFCTPGFVTSITALLADN
PDPSDEEIREGLSGNFCRCTGYQGIVNAVRLAAERTRNGQTVSP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagttgccggtcgagttgacggtcaacggccgcaaccatcgcggagtggtggag
ccgcgtatcacgttggccgacttcctgcgcgagacatgcggtctcaccggcacgcaccta
ggctgcgagcacggggcgtgcggtgcgtgcacggtgctgctcgacgggcaggcggtccgg
tcctgtctggtgttcgcggtgcaggccgacggccaggaggtcaccaccgtcgaaggcatc
gccggacccgacggtgagctctcccccgtgcaggccgcgatgaaggaatgccacggactc
caatgcggtttctgcacaccgggcttcgtcacctcgatcacggcgctgctggccgacaac
ccggatccgagcgacgaggagatccgcgaagggttgtcgggcaacttctgccgatgcacg
ggataccagggcatcgtcaacgccgtccgcctcgccgccgagcgcacgcgcaacgggcag
accgtaagcccgtag

DBGET integrated database retrieval system