KEGG   Mycobacterium sp. KMS: Mkms_4695Help
Entry
Mkms_4695         CDS       T00442                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00071  Fatty acid degradation
mkm00280  Valine, leucine and isoleucine degradation
mkm00281  Geraniol degradation
mkm00310  Lysine degradation
mkm00360  Phenylalanine metabolism
mkm00362  Benzoate degradation
mkm00380  Tryptophan metabolism
mkm00410  beta-Alanine metabolism
mkm00627  Aminobenzoate degradation
mkm00640  Propanoate metabolism
mkm00650  Butanoate metabolism
mkm00903  Limonene and pinene degradation
mkm00930  Caprolactam degradation
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01212  Fatty acid metabolism
Module
mkm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mkms_4695
   00650 Butanoate metabolism
    Mkms_4695
  Lipid metabolism
   00071 Fatty acid degradation
    Mkms_4695
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mkms_4695
   00310 Lysine degradation
    Mkms_4695
   00360 Phenylalanine metabolism
    Mkms_4695
   00380 Tryptophan metabolism
    Mkms_4695
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mkms_4695
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mkms_4695
   00281 Geraniol degradation
    Mkms_4695
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mkms_4695
   00627 Aminobenzoate degradation
    Mkms_4695
   00930 Caprolactam degradation
    Mkms_4695
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mkms_4695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Lactamase_B_5
Motif
Other DBs
NCBI-ProteinID: ABL93886
JGI: Mkms4695
UniProt: A1UM28
Position
complement(4919205..4920101)
Genome map
AA seq 298 aa AA seqDB search
MADAEQVTYETLDDGRIARIWLNRPHTQNAQSRTLLVQLDEAFGRAEADDQVRVVILAAR
GKNFSAGHDLGSEEAIAERGPGPAQHPTFRINGATRPAIAEKIYLQEWHYFFENTRRWRD
LRKITIAQVQGNAISAGLMLIWACDLIVASDDAKFSDVVAVRLGMPGVEYYAHPWEFGPR
KAKELLLTGDSIDADEAHRLGMVSKIFPRAELEDKTVEFARRIAALPTMAALLVKDSVNA
AADAMGFTEALRHGFHIHELGHAHWAAHNENRVAVGMPPDVPDWRELGAPKLARRDEP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgccgagcaggtgacctacgagaccctcgacgacgggcgcatcgcgcggatc
tggctgaaccggccgcatacgcagaacgcccagtcccggacgctgctggtgcagctggac
gaggcgttcgggcgcgcggaggccgacgatcaggtgcgggtggtgatcctggccgcgcgc
ggcaagaacttctccgccggccacgacctcggatccgaggaggccatcgccgaacgcggc
cccggtcccgcgcagcatccgacgttccggatcaacggtgcgaccaggcccgccatcgcg
gagaagatctacctgcaggagtggcactacttcttcgagaacacccggcggtggcgcgat
ctgcgcaagatcacgatcgcccaggtgcagggaaatgcgatctcggcggggctgatgctg
atctgggcgtgcgacctcatcgtcgcctccgacgacgcgaagttcagcgacgtggtggcg
gtccggctgggtatgccgggtgtcgagtactacgcccacccgtgggagttcggtccgcgc
aaggccaaagagctgctgctgaccggtgattcgatcgacgccgacgaggcgcatcgcctg
ggtatggtgtcgaagatcttcccgcgcgccgaactcgaggacaagacggtcgaattcgcg
cgccggatcgccgcactgccgacgatggcagcactgctggtcaaggattcggtcaacgcc
gccgccgacgcgatgggattcaccgaggcactgcggcacggcttccacatccacgagctc
gggcatgcgcactgggcggcgcacaacgagaaccgcgtggccgtcggcatgccgccggac
gtgccggactggcgcgagctgggcgcaccgaagttggcccggcgcgacgagccgtga

DBGET integrated database retrieval system