KEGG   Mycobacterium sp. KMS: Mkms_4748Help
Entry
Mkms_4748         CDS       T00442                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mkms_4748
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mkms_4748
   00650 Butanoate metabolism
    Mkms_4748
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mkms_4748
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mkms_4748
   00622 Xylene degradation
    Mkms_4748
   00621 Dioxin degradation
    Mkms_4748
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mkms_4748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4976460..4977392)
Genome map
AA seq 310 aa AA seqDB search
MPEKLQVAIVGSGNISTDLLYKLQRSEYLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQDDKPDLVFEATSAYVHRAAAPRYEEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVTRAVTEQGGTVPYAEIVASVSSSSAGPGTRANIDEFTKTTS
KGVQTIGGAARGKAIIILNPADPPMIMRDTIFCAIPEDVDRDAIAQSIRDVVAEVQTYVP
GYRLLNDPQFDDPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIAKE
SLSLAGGAQA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaagcttcaggtcgcgatcgtcgggtccggcaacatcagcaccgatctgctg
tacaagctgcagcgctcggagtacctcgaaccgcgttggatgatcggaatcgatcccgag
tccgaagggctcgcgcgcgcacgcaaactcggcctcgagacctcgcacgagggcgtggat
tggctgctcgcccaggacgacaaaccggatctggtgttcgaggccaccagcgcctacgtg
caccgggcggcggcaccgcgctacgaggaagcgggtatccgcgccatcgacctcaccccg
gccgcggtgggcccggcggtgatcccgccggccaacctgcgcgaacacctcgacgcaccg
aacgtcaacatgatcacctgtggtgggcaggccaccatccccatcgtctacgcggtcacc
cgcgcggtcaccgaacagggcggcacggtgccctacgccgagatcgtcgcctcggtgtcg
tcgagttcggcgggtccgggtacccgcgccaacatcgacgagttcaccaagaccaccagc
aagggtgtgcagaccatcggcggtgccgcgcgggggaaggcgatcatcatcctcaacccc
gccgatccgccgatgatcatgcgcgacaccatcttctgtgccatccccgaggacgtcgac
cgggatgcgatcgcccagtcgatccgcgacgtcgtcgccgaggtgcagacctacgtaccc
ggctaccgcctgctcaacgacccgcagttcgacgacccctcgatcaactccggcggacag
gccgtggtcaccacgttcgtggaggtggaaggcgcaggcgactacctgccgccgtacgcg
ggaaacctcgacatcatgaccgccgcggcggccaaggtgggcgaggagatcgcaaaggaa
tccctttctctggcaggaggtgcgcaggcatga

DBGET integrated database retrieval system