KEGG   Mycobacterium sp. KMS: Mkms_4852Help
Entry
Mkms_4852         CDS       T00442                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mkms_4852
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mkms_4852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5080694..5081224)
Genome map
AA seq 176 aa AA seqDB search
MTRVVLSIGSNVGDRLARLQSVVDGLGEAVRAVSPVYETAAWGGVEQGAFLNAVLIADDP
DLDCHGWLRRGQQLEQEADRVRGQRWGPRTLDVDIVTCHDGDTEVRSATAELTLPHPYAH
LRGFVLMPWLAAEPEATLTVADTTRPVSLWLEELDYAERAGVRRTDLALRTEIAAD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgagtcgtgttgtccatcgggtcgaatgtgggtgaccgcctggcacgcctgcag
tccgtcgtcgacggtctcggggaggccgtgcgcgcggtgtcgccggtgtacgagaccgcg
gcgtggggcggtgtcgaacagggcgccttcctcaacgcggtgctgatcgccgacgacccc
gacctcgactgccacggctggctgcgccgcggtcagcagttggagcaggaggccgaccgg
gtccgcggacagcggtgggggccccgcaccctcgacgtcgacatcgtcacctgccacgac
ggggacaccgaagtgcgttccgcgactgcggagctcacgctgccgcatccgtacgcacat
ctgcgggggttcgtcctgatgccgtggctggcggccgaaccggaggcgacgctgacggtg
gcggacacgacacggccggtctcgctgtggctggaggaactcgactacgccgagcgcgcg
ggtgtgcggcgcaccgacctggccctgcgcacggagatcgcggccgactga

DBGET integrated database retrieval system