KEGG   Mycobacterium sp. KMS: Mkms_4854Help
Entry
Mkms_4854         CDS       T00442                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mkms_4854
Enzymes [BR:mkm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mkms_4854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5081595..5082422)
Genome map
AA seq 275 aa AA seqDB search
MSATAVQVMGVVNVTDDSFSDGGQFLDPGHAVAHGMALAAEGAAIIDVGGESTRPGATRV
DPEVEAARIIPVVEALAAAGITVSIDTMRARVASAALEHGAAIVNDVSGGRADPDMARVV
ADARVPWILMHWRSVAAERPHQVPVYDDVVGEVRTELLASVDAAVAAGVDPMNLIIDPGL
GFAKTGQHNWALLHALPELVATEIPVLVGASRKRFLGALLADAYGAVRPPDGRETATAVI
SALAALHGAWGVRVHDVRASVDAVKVVGAWERGGE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccaccgcggtccaggtgatgggggtcgtcaacgtcaccgacgactccttctcc
gacggaggccagttcctcgacccgggtcacgccgtcgcacacggtatggcgctggcggcc
gagggggcggcgatcatcgacgtcggtggtgagtccacccggcccggcgccacccgggtc
gatcccgaagtcgaagcggcccgcatcatcccggtggtcgaagcgctcgccgcggccggc
atcacggtcagcatcgacacgatgcgcgcccgggtggcgagcgccgccctggaacacggc
gccgcgatcgtcaacgacgtgtccggcggcagggccgaccccgacatggcgcgcgtggtc
gccgacgcccgggtgccgtggatcctcatgcactggcggtcggtcgccgccgaacgcccg
caccaggtgcccgtatacgacgacgtcgtcggcgaggtgcgtacggaactgctggccagt
gtggacgccgcggtcgccgcgggcgtggacccgatgaacctgatcatcgacccgggcctc
ggattcgccaagaccggacaacacaattgggcactgctgcacgcactgcccgagctggtg
gcgaccgagatcccggtgctggtgggtgcgtcacgcaaacgttttctcggtgcgctgctc
gccgacgcctacggtgcggtgcgtccccccgacggccgggagacggccaccgcggtgatc
tccgcgctggccgcgctgcacggtgcgtggggtgtgcgcgtgcacgacgtgcgcgcctcg
gtggatgccgtcaaagtggtgggggcgtgggagcgaggtggggagtga

DBGET integrated database retrieval system