KEGG   Mycobacterium sp. KMS: Mkms_4855Help
Entry
Mkms_4855         CDS       T00442                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mkm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5082419..5083024)
Genome map
AA seq 201 aa AA seqDB search
MTRSYDSATVKIADFDQPRAEAAVRELLIAIGEDPDRHGLVDTPARVARAYREMFAGLYT
DPDDVLNTTFDEQHDEMVLVKDIPMYSTCEHHLVAFHGVAHVGYIPGVDGRVTGLSKLAR
VVDLYAKRPQVQERLTAQVADALMRKLDPRGVIVVMEAEHLCMAMRGIRKPGATTTTSAV
RGQFKTDKASRAEALDLILRK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggtcgtacgattcggccacggtcaagatcgccgatttcgaccagccgcgtgcg
gaggcggcggtgcgcgaactgctgatcgcgatcggggaggatccggaccggcacgggctg
gtggacaccccggcccgggtggcgcgggcctaccgggagatgttcgcggggctgtacacc
gatcccgacgacgtcctcaacacgacgttcgacgaacagcacgacgagatggtgctggtc
aaggacatcccgatgtactccacgtgcgaacaccacctcgtggcgttccacggagtggcg
cacgtggggtacatcccgggcgtcgacggccgggtgacggggttgtcgaagctcgcgcgg
gtggtcgacctgtacgcgaagcgtccgcaggtgcaggagcggctgaccgcccaggtcgcc
gacgcgctgatgcgcaaactcgacccgcgcggggtgatcgtggtgatggaagccgagcac
ctctgcatggccatgcgcgggatccgcaaacccggcgccaccaccaccacctccgcggtc
cgcggtcagttcaagaccgacaaagcttcgcgggccgaggcgctggatctgatcttgcgc
aagtga

DBGET integrated database retrieval system