KEGG   Mycobacterium sp. KMS: Mkms_4962Help
Entry
Mkms_4962         CDS       T00442                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mkms_4962 (glpK)
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mkms_4962 (glpK)
Exosome [BR:mkm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mkms_4962 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5201023..5202555)
Genome map
AA seq 510 aa AA seqDB search
MRESALAEFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPRAGWVEHNPVEIWERT
ASVLMSALNRTDLSAGDLCALGITNQRETALVWNRRTGRPYYNAIVWQDTRTDRIATALD
RDGRGDVIRRKAGLPPATYFSAGKVQWILDNVDGVREAADKGDAIFGTADSWVVWNLTGG
PRGGVHVTDVTNASRTMLMDLETLDWDDELLSFFGIPRQMMPEIKPSSCPDCHGVTREDG
PLGGEVPIAGILGDQQAAMVGQVCLSAGEAKNTYGTGNFLLLNTGEKIVRSENGLLTTVC
YQFGDAKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGVYFVPAFSG
LFAPYWRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAMEADSGVHLEVLKVDG
GITVNDLCMQIQADVLGVDVVRPVVAETTALGAGYAAGLAVGFWDGADDLRRNWQEDKRW
TPQWSDDQRAEGYAGWQKAVQRTLDWVDVE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagggagagcgcattggccgagttcgtcgccgccatcgatcaggggaccaccagtacc
cggtgcatgatcttcgaccacgacggcgccgaggtcggccggcaccagctcgaacacgag
cagatcctgcccagggccggctgggtcgaacacaacccggtggagatctgggagcgcacc
gcatcggtcctcatgtcggcgctcaaccgcaccgacctctcggccggggacctgtgcgcg
ctcggtatcaccaaccagcgggagacggcgctggtgtggaaccgtcgcaccgggcggccg
tactacaacgcgatcgtgtggcaggacacccgcaccgaccgcatcgccacggcgctcgac
cgggacgggcgcggagacgtgatccgccgcaaggccgggttgccgccggcgacgtacttc
tccgcgggcaaggtgcagtggatcctcgacaacgtcgacggtgtgcgcgaggccgccgac
aagggtgacgcgatcttcggcaccgccgacagctgggtggtgtggaacctgaccggcgga
ccgcgcggcggcgtgcacgtcaccgacgtgaccaacgccagccgcaccatgctgatggat
ctggagacgctggactgggacgatgaactgttgtcgttcttcgggattccgcgccagatg
atgcccgagatcaaaccgtcgtcgtgcccggactgccacggtgtcacccgggaggacgga
ccgctcggcggtgaggtgccgatcgccggcatcctcggtgaccagcaggccgcgatggtc
gggcaggtgtgcctgtcggcgggcgaggccaagaacacctacggcacaggcaatttcctg
ctgctcaacaccggcgagaagatcgtccgctccgagaacggtctgctcaccacggtctgc
taccagttcggtgacgcgaaacccgtttacgcccttgagggttcgatcgcggtgacgggg
tcggccgtgcaatggctgcgcgatcagctcggcatcatcagcggtgcctcgcagagcgag
tcgctggcgcgtcaggtcgaggacaacggcggggtgtacttcgtgccggcgttctccggg
ctgttcgcaccgtactggcgctcggatgcccgcggcgccatcgtcggcctgtcccggttc
aacaccaacgcccacgtcgcgcgggcgacgctggaggcgatctgctaccagagccgcgat
gtcgtcgacgcgatggaggccgactcaggtgtgcatctcgaggtgctcaaggtcgacggc
ggcatcaccgtcaacgatctgtgcatgcagatccaggccgatgtgctcggcgtcgacgtg
gtccggccggtggtggccgaaaccaccgctctcggtgcaggttacgcggccgggttggcg
gtcgggttctgggacggcgccgacgatctgcggcgcaactggcaggaggacaagcgctgg
actccgcagtggagcgacgatcagcgcgccgaggggtacgccggctggcagaaggccgta
cagcgcaccctggactgggtcgacgtcgagtga

DBGET integrated database retrieval system