KEGG   Mycobacterium sp. KMS: Mkms_5203Help
Entry
Mkms_5203         CDS       T00442                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mkms_5203
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mkms_5203
    3.5.1.-  
     Mkms_5203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5445392..5445946
Genome map
AA seq 184 aa AA seqDB search
MRALIVVDVQNDFCEGGSLAVTGGAAVARRISDLLADGTARYDHIVATKDFHIDPGEHFS
DTPDYRVSWPRHCVVGTDGAEFHPDLDPSPVEAVFTKGEYSAAYSGFEGSDASGTPLGDW
LRERGVDEVDVVGIATDYCVRATAADAAAAGFTTRVLLDLTAGVAEDSTADAVRALRDAG
VAVV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcatcgtcgtcgacgtccagaacgacttctgcgaaggcggctcgctggcc
gtgaccggcggggccgccgtcgcccggcggatcagcgacctcctcgcggacggcaccgct
cgctacgaccacatcgtggcgaccaaggacttccacatcgacccgggcgagcacttctcc
gatacgcccgactatcgggtgtcgtggccccgtcactgtgtcgtcggcaccgacggcgcg
gagttccaccccgacctggatccgtccccggtcgaggcggtgttcaccaagggtgagtac
tcggcggcctacagcggcttcgagggcagcgacgcgtcgggcacgccgctgggtgactgg
ctgcgcgagcgcggcgtcgacgaggtcgacgtggtcgggatcgccaccgactactgcgtc
cgggccaccgcggcggatgcggcggcggccggtttcaccacccgggtgctgctcgacctc
accgcgggtgtcgccgaggactcgaccgccgacgcggtccgagcgctgcgcgacgccggc
gtcgccgtcgtctga

DBGET integrated database retrieval system