KEGG   Mycobacterium sp. KMS: Mkms_5390Help
Entry
Mkms_5390         CDS       T00442                                 

Definition
(GenBank) Cellulase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00500  Starch and sucrose metabolism
mkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mkms_5390
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mkms_5390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: ABL94576
JGI: Mkms5390
UniProt: A1UP18
Position
complement(5625002..5625991)
Genome map
AA seq 329 aa AA seqDB search
MSSAVGAVARWVAPFLTVAAVAGTAAVAEPVNVDPAPAVRLVSDANPLVGRPFYVNPASK
AMRAVQGNSDPLLASVANTPTAYWMDHLSTPSVDSKYIADAQAAGTTPILALYGIPNRDC
GSFAAGGFGSAGAYRAWIDGVAGAIGGGPAAVVLEPDALAMIDCLSPGQQQERLELIGYA
VDTLTRNPATAVYVDAGHPRWVAADVMAGRLNQVGVAKARGFSLNTANFFTTEESIGYGQ
AVSGMTNGSHFVIDTSRNGVGPVDSDSWCNPPGRALGTPPTTATGHPQVDAFLWVKRPGE
SDGSCGGGAPSAGTFVAQYAIDLARTAGW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagctgttggtgcagtcgcgcggtgggtcgcgccgttcctgacggtcgcggcc
gtcgcgggtacggccgccgtcgccgaacccgtgaacgtcgaccccgctccggcggtgcgt
ctggtcagcgatgcgaacccgctggtcggcaggcccttctatgtcaatccggcgtccaag
gccatgcgggcggtgcagggcaactcggacccgttgctggcttcggtcgccaacaccccg
acggcgtactggatggatcacctctccaccccgtcggtcgactcgaagtacatcgccgac
gcacaggccgcgggcaccacaccgatcctggcgctgtacggcatccccaaccgcgactgc
gggagcttcgccgcgggcggattcggctcggccggggcgtatcgagcgtggatcgacggc
gtggccggagccatcggagggggcccggcggcggtcgtcctcgaacccgacgcgctggcc
atgatcgactgcctgtcaccgggccagcagcaggaacgcctcgagctgatcggctacgcc
gtcgacaccctgacccgcaacccggccaccgcggtgtacgtggacgccggtcatccgcgc
tgggtggccgccgatgtgatggccggccggctgaaccaggtcggcgtcgccaaggcgcgc
ggcttcagcctcaacaccgccaacttcttcaccaccgaggagtcgatcggctacggccag
gccgtctcggggatgacgaacggatcgcacttcgtgatcgacacgtcgcgcaacggcgtc
ggaccggtcgacagcgattcgtggtgcaaccctcccggccgcgcgttgggcaccccgccc
acgacggccaccggccacccgcaggtcgacgccttcctgtgggtcaagcgtcccggtgag
tccgacggatcgtgcggcggcggggcgcccagcgcgggcacgttcgtcgctcagtacgcc
atcgatctggcccgcaccgcaggctggtag

DBGET integrated database retrieval system