KEGG   Mycobacterium kansasii: MKAN_03485Help
Entry
MKAN_03485        CDS       T02887                                 

Definition
monoamine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mkn  Mycobacterium kansasii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MKAN_03485
   00330 Arginine and proline metabolism
    MKAN_03485
   00340 Histidine metabolism
    MKAN_03485
   00350 Tyrosine metabolism
    MKAN_03485
   00360 Phenylalanine metabolism
    MKAN_03485
   00380 Tryptophan metabolism
    MKAN_03485
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     MKAN_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796722..798086
Genome map
AA seq 454 aa AA seqDB search
MADVDVCVVGGGFAGLTAALRLKQAGHSVTLLEARDRVGGRTFTVQRDDGSWIDKGGAWI
GPTQDRIHALMKEFGVASFKQYTGGEAMMVVDAKQYRYQGTVPWTLSPWASLNLGAAMFE
LTQMCKTIPLEAPWEAKKAARWDRMTLAQWLRKNLVSKAAHDLLETAIAGTYTSDASEVS
MLFVLYQMASGGGPGFVLGGEGGSQDSRPVGGMGAIYGPMAAELGDVIRLSQPVRSITQD
ADGVTVQSDGMTVRARRAIVAVPLAIASHIAYAPMLPTDRSFLHQRMPSGAVVKISTVYD
EPFWRSDGLSGQSAAPGSLATLTIDGCPDTGGPGVLVVVIEGPIARQYERLDEAGRRQAV
LDALVDRFGTKAGRPVDYVEQNWSRERYSGGGMISHAPPGVLTQFGHALRRPCGRIHWAG
TETSATMCGWIDGAIRSGERAASEVMTTETLTVA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacgtcgatgtctgcgtggtgggcggcgggttcgctggcctgaccgcggcgctt
cggctcaaacaggccggccattcggtgacattgctcgaggcgcgcgaccgcgtgggcggg
cgcaccttcaccgtccagcgtgacgacgggtcctggatcgacaagggcggcgcctggatc
gggccgacccaggaccgaatccatgcgctgatgaaagaattcggggtcgcgagcttcaag
cagtacaccggcggcgaggcgatgatggtcgtcgacgccaagcaatatcgctaccagggc
acggtcccgtggacgctgagcccgtgggcgtcgctgaatctgggcgcggcgatgttcgag
ctcacccagatgtgcaagacgattcccctcgaggcgccatgggaagccaagaaggccgcg
cgatgggatcgcatgacgttggcccagtggctgcgcaagaacctcgtgtccaaggccgcg
cacgacctgctggaaaccgcgatcgccggcacctacacctcggatgcttccgaggtgtcc
atgctgttcgtcctatatcagatggcgtccggcggagggcccggtttcgtactgggtggc
gagggcggctcacaggactcccgcccggtcggcggcatgggagcgatctacgggccgatg
gccgccgagctgggtgacgtgatccggctgtcccagccggtacgctccatcacccaggac
gccgacggggtcaccgtgcagtcggacggtatgacggtgcgggcgcggcgggcaatcgtc
gcggtgccgctggctatcgccagccacatcgcttatgcgccaatgcttcccaccgatcgg
tccttcttgcaccagcggatgcccagcggtgcggtggtcaagatctcgaccgtctacgac
gaaccgttctggcgcagcgacggcctctccggccaaagcgccgcgccgggatcgctggcg
acgctcaccatcgacggctgccccgacaccggcggccccggcgtgctggttgtggtcatc
gagggtcccattgcgcggcaatacgagcgccttgatgaggccgggcgccgtcaggcggtg
ctcgacgccctggtggaccggttcggcaccaaggccggaaggccggtggactacgtggag
cagaactggagccgtgagcgctattccgggggcgggatgatcagccacgcgcccccgggc
gtgctcacccagttcgggcatgcactacgcaggccgtgcgggcgcatccactgggcgggc
accgagacatcggccactatgtgcggctggatcgatggcgcgattcgctccggtgagcgg
gccgccagcgaagtcatgacgaccgagacgctcacggtggcttga

DBGET integrated database retrieval system