KEGG   Mycobacterium kansasii: MKAN_05270Help
Entry
MKAN_05270        CDS       T02887                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mkn  Mycobacterium kansasii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MKAN_05270
Enzymes [BR:mkn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MKAN_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188696..1189610
Genome map
AA seq 304 aa AA seqDB search
MFADNVMTGPSVVNVGTMTARRVCVVGSLNMDLTFAVTTLPRPGETVLASALNCAPGGKG
GNQAVAAARAGAHVQFVGAVGDDAAADQLRAHLLANGVGIDGMVRVPGPSGTAIIVVDTG
AENTIVVAPGANGQLKLPPAAVGDCDVLLTQLEIPPETAVAAARQARSAGAIVMVNVSPA
GRLHGAGPELSAVADVVIANESEAQQWRWSPAHLVVTCGARGARYVGVDGELDVAAPAVT
AVDTTGAGDVFAGVLAAHWPPDGASPAQRLRALQRACAAGALATTVAGAGDCAPPADAIE
AALT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgacaatgtgatgaccgggccgagcgttgttaacgtcggcacaatgacggcg
cggcgagtctgtgtggtgggcagcctgaacatggatctgacgttcgccgtcaccacgctg
ccgcgcccgggcgagacggtgctggcatcggcactgaactgtgcgcccggtggcaagggc
ggtaatcaggcggtagccgccgcacgcgcgggcgcgcacgtccagttcgtcggcgccgtg
ggcgacgacgcggctgccgaccagctgcgggcccacctgctggccaacggtgtcggcatt
gacggaatggtccgggtgcccggcccgagcgggacggcgatcattgtggtcgataccggc
gccgagaacaccatcgtggtggctcccggcgcgaatgggcagctgaagctgccgcccgcg
gcggtcggcgactgcgacgtgttgctgacccagttggagattccgccggagacggcggtg
gccgcggcccggcaggcccggtcggccggggcaatcgtcatggtcaatgtctccccggcc
ggccgactgcacggcgccgggcccgaattgtcggcggtggccgacgtcgtgatcgccaac
gagtccgaagcccagcaatggcgttggtcgccggcccacctcgtggtcacctgcggcgcg
cgcggtgcccgctacgtcggtgtcgacggcgaactggacgtggccgcccccgcagtgacc
gcggtggacaccaccggagccggtgacgtattcgccggggtcctggctgcccattggcca
ccggacggtgcttcgccggcccagcgactgcgcgcgttgcagcgagcctgcgcggcaggg
gcactggcgaccacggtggcgggcgccggagattgtgcgccgcccgccgatgcgatcgag
gcggcactcacctag

DBGET integrated database retrieval system