KEGG   Mycobacterium kansasii: MKAN_06255Help
Entry
MKAN_06255        CDS       T02887                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mkn  Mycobacterium kansasii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MKAN_06255
Enzymes [BR:mkn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MKAN_06255
Exosome [BR:mkn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MKAN_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1399323..1401539
Genome map
AA seq 738 aa AA seqDB search
MSDVSRSNSRTDQLPGTHLAPDPAELARLVAGAHHNPHSILGAHEYGDHTVIRAFRPHAA
SVVALVGDDQLPMQHIDAGLFAVALPFVNLIDYRLQVSYEGADPYTVADAYRFLPTLGEV
DLHLFAEGRHERLWEVLGAHPRSFTTADGDVEGVSFAVWAPNAKGVSLIGDFNGWTGNDA
PMRVLGSSGVWELFWPGFPADGLYKFRVHGADGVVTDRADPFAFGAEVPPQTASRVTVSN
YTWGDADWMTGRAQRNPVFEPMSTYEVHLGSWRPGLSYRQLARELTDYVVEHGFTHVELL
PVAEHPFAGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWA
LGRFDGTALYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWLQEFHVDGLRVDAV
ASMLYLDYSRPEGGWTPNIYGGRENLEAVQFLQEMNATAHRVAPGIVTIAEESTSWPGVT
RPTSLGGLGFSMKWNMGWMHDTLDYIRRDPVYRSFHHHEMTFSMLYAFSENYVLPLSHDE
VVHGKGTLWGRMPGNNHMKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQNGLDWF
QLDEQGFSNGILRLVRDINDIYRNHPALWSQDTVPAGYSWIDANDSANNVLSFLRYGNDG
SVMACVFNFAGTEHGGYRLGLPAAGRWREVLNTDATDYNGTGVGNLGGVDATDDPWHGRP
ASAVLVLPPTSALWLEPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgtgagccgatccaatagccgaaccgatcaactgcccggaacacacttggcg
cccgaccccgccgagctggcgcgcctggtggccggcgcccaccacaacccgcacagcatc
ctgggcgcccacgaatacggcgaccacacggtcatccgggcatttcgtccgcacgcggcc
agcgtcgtcgcgctcgtcggtgacgaccaattgccgatgcagcacatcgacgccgggctg
ttcgcggtggcgctgcccttcgtcaacttgatcgactaccggttgcaggtcagctacgag
ggcgcagacccctatacggtcgccgacgcttaccgctttctgcccaccctgggtgaggtc
gacctccatctgttcgccgagggccgccacgagcgactctgggaagtccttggcgctcat
ccccgctcgttcaccacggccgacggtgacgtggagggtgtgtcgtttgcggtgtgggca
cccaatgccaagggcgtcagcctgatcggtgatttcaacggctggaccggaaacgacgcg
cccatgcgcgtgctgggttcctcgggagtgtgggagttgttctggccaggtttcccggcc
gacggcctctacaagttccgggtgcacggcgccgacggcgtcgtgaccgatcgggccgac
ccgttcgctttcggcgccgaggtgccgccccagacggcatcgcgcgtgacggtgagtaac
tacacctggggcgacgccgactggatgactgggcgtgcccagcgcaatccggtgttcgag
ccgatgagcacctacgaagtccacctgggttcctggcgtcccgggctgagctaccgccag
ctcgcccgtgaactgaccgattacgtggtggaacatgggttcacccatgtggagctactg
cccgtggccgagcaccccttcgccggatcctggggataccaggtcacgtcgtactacgcg
ccgacttcacgtttcggcacccccgacgatttccgggcgctggtcgacgcccttcaccaa
gccggcatcggggtcatcgtggactgggtgccggcccacttcccaaaggacgcctgggcg
ctcggacgcttcgacggcactgccctctatgagcattccgaccccaaacgtggcgagcaa
ctagactggggcacttacgttttcgacttcggccgtccggaggtacgaaactttctggta
gccaacgcgttgtactggctgcaggagtttcacgtcgacggcctgcgggtggacgcggtg
gcatcgatgctctacctggattactcgcgtcccgagggcggctggacccccaacatctac
ggcgggcgggagaacctggaggcggtgcagttcctgcaggagatgaacgccaccgcgcac
cgggtagcgccgggcattgtcaccatcgccgaggagtcgacgtcgtggccgggggtgacg
agaccgacgagccttggcggccttggcttttcgatgaaatggaacatgggctggatgcac
gacacgctcgactacattcgtcgcgacccggtctatcgcagctttcatcaccatgagatg
acgttctcgatgctgtatgcgttcagcgagaactacgtgctgccactcagccatgacgag
gtggtgcacggcaaggggacgctgtggggccggatgccgggtaacaaccacatgaaggcc
gccgggcttcgcagtctgctcgcctaccagtgggcgcacccgggcaaacaactgctgttc
atgggccaggaattcggccagcgtgccgaatggtccgagcaaaacggtctggactggttc
cagctcgacgaacaaggcttctcgaacggaatcctgcgtctggtgcgcgacatcaacgac
atctaccgcaaccacccggcactgtggagccaggacaccgttccggcgggctattcctgg
atcgacgccaacgattcggccaacaacgtcttgagcttcctgcgctacggcaacgacggc
tccgtgatggcctgcgtgttcaacttcgcgggcaccgagcacggcggctaccggctcggc
ctcccggcggcgggccgctggcgcgaggtcctcaacacagacgcgaccgactacaacggg
accggagtgggcaacctcgggggcgtcgacgccaccgacgacccgtggcatggccgcccc
gcatcggcggtgctggtgctgccgccgacgtcggcgttatggctggagccggcctag

DBGET integrated database retrieval system