KEGG   Mycobacterium kansasii: MKAN_15865Help
Entry
MKAN_15865        CDS       T02887                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mkn  Mycobacterium kansasii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MKAN_15865
Enzymes [BR:mkn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MKAN_15865
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MKAN_15865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3462147..3463952
Genome map
AA seq 601 aa AA seqDB search
MELMNDAREASRHDPAHHPAEGSHVEGGVVEHPDAKDFGNAAALPADPTWFKHAVFYEVL
VRAFYDSSADGSGDLRGLLDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPDF
GTVDDFVALVDAAHRRGIRVITDLVMNHTSESHPWFQESRRDPDGPYGDYYVWSDTSQKY
TDARIIFVDTEESNWTFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVMRFWLGLGID
GFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPADVVEYFG
DATTGGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPPIPDMAQWGIFLRNHDELT
LEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIQLFNALLLSLPGSPVLY
YGDEIGMGDVIWLGDRDGVRTPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEA
QRDTSTSLLNWTRTMLAVRRRHQAFAVGSFQELGGSNPSVLAFVRETPGSDGRDGDVVLC
VNNLSRFPQPIELNLQQWNSYTPIELTGHVEFPPIGHLPYLLTLPGHGFYWFQLSRTEEN
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtggagttgatgaacgacgcaagagaagcctcccggcacgatcctgcgcaccatcccgcc
gagggcagccatgtcgaagggggtgtggtcgagcaccccgatgccaaggatttcggcaat
gccgccgcgcttcccgctgacccgacctggttcaagcacgccgttttttacgaggtgctg
gtccgggctttctacgattccagcgcggacggctcgggtgatctgcgtggactcctggac
cggctggactacctgcagtggctcggcatcgactgcatctggctgcccccgttctacgac
tcaccgctgcgtgacggcggctacgacatccgcgacttctacaaggtgctgcccgacttc
ggcaccgtcgacgactttgtcgccctggtcgatgccgcccaccgccgggggatccgggtg
atcaccgacctggtgatgaatcacacctcggaatcccacccgtggttccaggaatcccgc
cgcgaccccgacgggccgtacggcgactactacgtgtggagcgataccagccagaagtac
accgacgcccggatcatcttcgtcgacaccgaagagtcgaactggacgttcgacccggtc
cgccgccagttctactggcaccgtttcttctcccaccagccggacctcaattacgacaat
ccggccgttcaagaggcgatgatcgacgtcatgcgcttctggctgggcctgggcatcgac
gggttccggctggacgcggtcccctaccttttcgaacgcgagggcaccaactgcgaaaac
ctgcccgagacgcacgccttcctcaagcgcgtccgcaaggtggtggacgacgaatttccc
ggccgggtgctgctggccgaggccaaccagtggccggccgacgtcgtcgagtacttcggc
gacgccaccaccggcggcgacgaatgccacatggcctttcacttcccgctgatgccgcgc
atcttcatggccgtccgccgcgagtcgcggttcccgatttcagagatcctggcgcagacg
ccgccgatacccgatatggcgcaatgggggatcttcctgcgcaaccatgatgagttgacg
ctggaaatggtcaccgacgaagagcgcgactacatgtacgccgagtacgccaaagacccg
cggatgaaggcgaacgtcggcatccgccgccggctggcgccgctgctggataacgaccgc
aaccagatccagttgttcaacgcgctgctgctctcgttgccgggctcgccggtgctgtac
tacggcgacgaaatcggcatgggtgacgtgatctggctgggggaccgcgacggcgtgcgg
accccgatgcagtggacaccggaccgtaacgccggattctccacagccaaccccggccgg
ctctacctgccgccgagccaggatccggtttacggctaccaggcggtcaacgtcgaggcg
cagcgcgacacctcgacatcactgctgaactggacccggaccatgcttgcggtgcggcgg
cgccaccaggcgttcgccgtcgggtccttccaggaactgggcgggtccaacccgtcggtc
ctggctttcgtccgggaaacgccgggcagtgacggcagagacggtgatgtggtgctttgc
gtgaacaacctctcccggttcccgcagcccatcgaactgaacctgcagcaatggaacagc
tacacaccgatcgagctcaccgggcatgtggaatttccccctatcggccacctgccctac
ctgctgaccctgccgggccacggcttttactggttccagttgtccagaaccgaggagaat
gcatga

DBGET integrated database retrieval system