KEGG   Mycobacterium kansasii: MKAN_16015Help
Entry
MKAN_16015        CDS       T02887                                 

Definition
NAD-dependent dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mkn  Mycobacterium kansasii
Brite
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MKAN_16015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3495018..3496052
Genome map
AA seq 344 aa AA seqDB search
MSTKPKLVIGANGFLGSHVARQLVEAGEQVRAMVRPKANTRSIDDLELTRFHGDVFDTAV
VREAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVEGLRNVLDVAVESPIAADLHRFVFTST
YATVGRRHGHVATEADVVDVHRVSPYVQSRVAAENLVMRYVSEAGLPAVALCVSTTYGSG
DWGRTPHGAFIAGAVFGKLPFLMTGIHLEAVGVDDAATAMILAAERGRNGERYLVSEKMI
ALTEVVRIAADEAGVPPPRRSISVPVLYALGALGSLRARLTGKDAELSLQSVRMMRAEAE
LDHGKAVRELGWQPRPVEDSIREAARFWAAMRTARPDAKTAASE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaagcccaaactcgtcatcggcgccaacggcttcctgggttcacacgtggcc
cgccagctcgtcgaagcaggcgaacaggtacgggcgatggtgcgccccaaagccaatacc
cggtcgatcgacgacctggagctcacccggtttcacggcgacgtcttcgacaccgcggtg
gtgcgcgaggcgatggccggctgcgacgacgtgtactactgcgtggtcgacacgcgcgcc
tggttgcgcgacccgtcgccgctgtttcgcaccaacgtcgaaggcctgcgcaacgtcttg
gacgtggccgtcgaaagcccgatagccgcggacctgcacaggttcgtcttcaccagcacc
tatgccaccgtgggccgccggcacgggcacgtggcgaccgaggccgacgtcgtcgacgtc
caccgggtgagtccctacgtccaatcccgggttgcggccgaaaacctggtgatgcggtac
gtgtcagaggcaggcctgcccgccgtcgcactgtgcgtctcaacgacctacggcagcggc
gactggggccgcacaccccatggcgctttcatcgccggcgcggtattcggcaagttgccc
ttcctgatgaccgggatccacctggaagccgtgggtgtcgacgatgccgccacagcgatg
atcctggcggccgagcgcggccgcaacggcgagcgttacctggtctcggagaagatgatc
gcgttgaccgaggtggtgcggatcgccgcggacgaggccggtgtgccgccgccgcgacgt
tcgatctcggtgccggtgctctatgcgctgggtgcgctgggcagcctgcgggcccggctc
accggcaaagacgccgaactcagcctgcagtcggtgcggatgatgcgcgccgaagccgag
ctcgatcacggcaaggccgtccgcgagctgggctggcagccacggccggtcgaagactcg
attcgcgaggccgcccggttctgggccgcgatgcgcacggcccggccggacgccaagacc
gcggcatcagagtag

DBGET integrated database retrieval system