KEGG   Mycobacterium kansasii ATCC 12478: MKAN_17345Help
Entry
MKAN_17345        CDS       T02887                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00220  Arginine biosynthesis
mkn00250  Alanine, aspartate and glutamate metabolism
mkn00290  Valine, leucine and isoleucine biosynthesis
mkn01100  Metabolic pathways
mkn01110  Biosynthesis of secondary metabolites
mkn01130  Biosynthesis of antibiotics
mkn01210  2-Oxocarboxylic acid metabolism
mkn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_17345
   00290 Valine, leucine and isoleucine biosynthesis
    MKAN_17345
   00220 Arginine biosynthesis
    MKAN_17345
Enzymes [BR:mkn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MKAN_17345
    2.6.1.66  valine---pyruvate transaminase
     MKAN_17345
Amino acid related enzymes [BR:mkn01007]
 Aminotransferase (transaminase)
  Class I
   MKAN_17345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGZ51851
UniProt: U5WV97
Position
complement(3792373..3793644)
Genome map
AA seq 423 aa AA seqDB search
MVDVTTHQLPWHASAHHRQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRILKLNIGN
PAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILSARRAVVTRYELVEGFPRFDVDDVYLG
NGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQSWQPDIADL
ESKITDRTKALVVINPNNPTGAVYSREILTQMVDLARKHQLLLLADEIYDKILYDDAKHI
SVASLAHDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHASSFIEGISLLANMRLCPNVP
AQHGIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPAGALYAFPRLDPE
VYDIADDEELVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERLGNFLVS
YRQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgtgactactcaccagctgccctggcacgcctccgcacatcatcggcagcgc
accttcgcgcagtcgtccaagctgcaggacgtcctgtacgaaatccgcggcccggtacac
caacacgccgcgcggctggaagccgaaggtcaccgcatcctcaagctcaacatcggcaac
ccggcgccgttcggtttcgaggcgcccgacgtgatcatgcgtgacatgatccaagcgctg
ccctacgcccagggatactccgactctcagggcattttgtcggcccgccgtgcggtggtc
acccgctacgagctggtcgagggcttcccgcgattcgacgtcgacgacgtctatttgggc
aacggggtgtccgagctgatcaccatgacgttgcaggccctgctggacaacggcgatcag
gtgttgatcccgtcaccggactacccactgtggacggcgtcgacctcgctggccggcggc
acgcccgtgcactacctctgcgacgagacccagagctggcagcccgacatcgccgacctg
gaatccaagatcaccgaccgcaccaaggccctggtcgtgatcaacccgaacaaccccacc
ggtgcggtctacagccgcgaaatcctcacccagatggtcgatttggcgcgcaagcatcaa
ctgctgctgctcgccgacgagatctacgacaagatcctctacgacgacgccaaacacatc
agcgtggcctcgctcgcccacgacatgttgtgcctgaccttcaacggtctgtccaaggca
taccgggtcgccggataccgggccggctggctggcgatcaccgggcccaaagaccacgcc
agcagcttcatcgagggcatcagtctgctggccaacatgcggctgtgcccaaatgtcccg
gcgcagcacggaattcaggtcgccctcggcggacaccagagcatcgaggatctagtgctt
cccggcggccggctgctcgagcagcgcgacgttgcctggaccaagctcaatgagattccc
ggggtctcgtgtgtcaagccggccggcgcgctgtacgcgtttccccgattggaccctgag
gtctacgacatcgccgacgacgaggaactcgtcctggacctcttgctgtccgagaaaatt
ctggtcacccagggcaccggattcaattggccggcacccgatcacctgcgcctggtgaca
ttgccgtggtctcgtgatcttgccgccgcgatcgagcggctgggtaacttcctggtcagc
taccgccagtag

DBGET integrated database retrieval system