KEGG   Mycobacterium kansasii: MKAN_17345Help
Entry
MKAN_17345        CDS       T02887                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mkn  Mycobacterium kansasii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MKAN_17345
   01230 Biosynthesis of amino acids
    MKAN_17345
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_17345
   00290 Valine, leucine and isoleucine biosynthesis
    MKAN_17345
Enzymes [BR:mkn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MKAN_17345
    2.6.1.66  valine---pyruvate transaminase
     MKAN_17345
Amino acid related enzymes [BR:mkn01007]
 Aminotransferase (transaminase)
  Class I
   MKAN_17345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3792373..3793644)
Genome map
AA seq 423 aa AA seqDB search
MVDVTTHQLPWHASAHHRQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRILKLNIGN
PAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILSARRAVVTRYELVEGFPRFDVDDVYLG
NGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQSWQPDIADL
ESKITDRTKALVVINPNNPTGAVYSREILTQMVDLARKHQLLLLADEIYDKILYDDAKHI
SVASLAHDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHASSFIEGISLLANMRLCPNVP
AQHGIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPAGALYAFPRLDPE
VYDIADDEELVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERLGNFLVS
YRQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgtgactactcaccagctgccctggcacgcctccgcacatcatcggcagcgc
accttcgcgcagtcgtccaagctgcaggacgtcctgtacgaaatccgcggcccggtacac
caacacgccgcgcggctggaagccgaaggtcaccgcatcctcaagctcaacatcggcaac
ccggcgccgttcggtttcgaggcgcccgacgtgatcatgcgtgacatgatccaagcgctg
ccctacgcccagggatactccgactctcagggcattttgtcggcccgccgtgcggtggtc
acccgctacgagctggtcgagggcttcccgcgattcgacgtcgacgacgtctatttgggc
aacggggtgtccgagctgatcaccatgacgttgcaggccctgctggacaacggcgatcag
gtgttgatcccgtcaccggactacccactgtggacggcgtcgacctcgctggccggcggc
acgcccgtgcactacctctgcgacgagacccagagctggcagcccgacatcgccgacctg
gaatccaagatcaccgaccgcaccaaggccctggtcgtgatcaacccgaacaaccccacc
ggtgcggtctacagccgcgaaatcctcacccagatggtcgatttggcgcgcaagcatcaa
ctgctgctgctcgccgacgagatctacgacaagatcctctacgacgacgccaaacacatc
agcgtggcctcgctcgcccacgacatgttgtgcctgaccttcaacggtctgtccaaggca
taccgggtcgccggataccgggccggctggctggcgatcaccgggcccaaagaccacgcc
agcagcttcatcgagggcatcagtctgctggccaacatgcggctgtgcccaaatgtcccg
gcgcagcacggaattcaggtcgccctcggcggacaccagagcatcgaggatctagtgctt
cccggcggccggctgctcgagcagcgcgacgttgcctggaccaagctcaatgagattccc
ggggtctcgtgtgtcaagccggccggcgcgctgtacgcgtttccccgattggaccctgag
gtctacgacatcgccgacgacgaggaactcgtcctggacctcttgctgtccgagaaaatt
ctggtcacccagggcaccggattcaattggccggcacccgatcacctgcgcctggtgaca
ttgccgtggtctcgtgatcttgccgccgcgatcgagcggctgggtaacttcctggtcagc
taccgccagtag

DBGET integrated database retrieval system