KEGG   Mycobacterium kansasii: MKAN_20150Help
Entry
MKAN_20150        CDS       T02887                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mkn  Mycobacterium kansasii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MKAN_20150
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_20150
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MKAN_20150
   00430 Taurine and hypotaurine metabolism
    MKAN_20150
Enzymes [BR:mkn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MKAN_20150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4398004..4399386
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPIPALRLPEESMDPEAAYQFIHDELMLDGSSRLNLA
TFVTTWMDPEAGQLMAETFDKNMIDKDEYPATAAIESRCVSMVADLFHAEGLRDDDPGSA
TGVSTIGSSEAVMLGGLAMKWRWRARTKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEKGRYVITPEQVIDAVDEDTIGVVAILGTTYTGELEPVAEICAALDGLAARGGVDVP
VHVDAASGGFVVPFLHPDLQWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEYLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSQTARWLGEQLEG
AEHCELISDGSAIPVVAFRLAGDRGYTEFDLSHELRTCGWQVPAYTMPDNATDISVLRIV
VREGLSADLARALHDDISTAVRTLDKVKPGGHYDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcagccacccgtccgtgcccgcgcactcgattgctccggcctacaccgggcgg
atgttcaccgcccctatcccggcgctccggttgcccgaggaatcgatggatccggaagcc
gcctaccagttcatccacgacgagctcatgctcgacggcagttcgcggctgaacctggcc
acctttgtcaccacctggatggaccctgaggctgggcagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggccatcgagtcccgctgtgta
tccatggtggccgaccttttccatgccgaggggctgcgcgacgacgacccgggcagcgcc
accggggtgtcgacgatcggctccagtgaggcggtaatgctgggtgggctggccatgaag
tggcgttggcgggcaaggaccaaggactggaagggtcgcacacccaacctggtgatgggc
tccaacgtgcaggtggtgtgggagaagttctgccggtacttcgacgtcgaaccccgttat
ctgccgatggagaaagggcgctacgtcattactcccgaacaggtcatcgatgccgtcgac
gaggacaccatcggtgtggtggcgattctgggcaccacctacaccggtgagctggagccg
gtcgccgagatctgcgcggcgctggacgggctggcagcccgcggcggggtggacgtcccc
gtgcacgtcgacgccgccagcggcggcttcgtggtgccgttcctgcatccggacctgcag
tgggacttccggctgccccgggtggtgtccatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcggccccgaatatctgcccgaggaactg
gtgttccgggtcaattacctgggcggggacatgccgacgttcacgctgaacttctctcgt
ccgggcaaccaggttgtcggccagtattacaacttcctgcggctgggccgcgagggttac
accaaggtcatgcaggcgctgtcgcagacggcgcggtggctcggcgagcagctggagggc
gccgagcattgcgagttgatctcggacggttcggcgattccggtggtcgccttccggctc
gccggggaccgcggttacaccgagttcgacctctcgcacgagttgcggacgtgcggatgg
caggtgccggcatacaccatgccggacaacgccaccgacatctccgtactgcgcattgtg
gtgcgggaaggactgtccgccgacctggcccgggcattgcatgacgacatctctaccgcg
gtgcgaaccctggacaaggtcaagcccggcgggcattacgacgcccagcacttcgcgcat
tag

DBGET integrated database retrieval system