KEGG   Mycobacterium kansasii: MKAN_20785Help
Entry
MKAN_20785        CDS       T02887                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mkn  Mycobacterium kansasii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MKAN_20785
Enzymes [BR:mkn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MKAN_20785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4551273..4552559
Genome map
AA seq 428 aa AA seqDB search
MTDFEFDAPTVIRTKRDGGRLSDAAIDWVIQAFTDGRVAPEQMSALLMAIFWRGMDSGET
ARWTSAMLASGTRMDFADLRLPTVDKHSTGGVGDKITLPLVPVVVACGAAVPQAAGRGLG
HTGGTLDKLESISGFTATLSNQRVRQQLCDVGAAIFAAGELAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGAGAFLKSEAQSRELARTMVDLGAAHGVPTRALL
TDMNSPLGRTVGNSLEVAEALEVLAGGGPLDVVELTVRLAGEMLQLAGIDRRDPAQTLRD
GSAMDRFRRLVDAQGGDLSKPLPIGRCSETVTADRSGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVAGEPLFTLYTETPERFGPALAMLDGGWSVGEAGPAPRP
LIIDRITR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgacggacttcgaattcgatgcgccgacggtaatccggaccaagcgcgacggtggtcgg
ttatccgacgccgccatcgactgggtgatccaggccttcaccgacggccgggtcgctccg
gaacagatgtcggccttgctgatggcgattttctggcgcggcatggactccggcgagacc
gccagatggacgtcggcgatgctggcttcggggactcggatggatttcgccgatctgcgg
ctgccgaccgtggacaagcactccaccggcggggtaggcgacaagatcaccctgccgttg
gtgcccgtcgtcgtcgcctgcggtgcggcggtgccgcaggccgcgggccgggggctcggc
cataccggcggcacgctggacaagctggaatccatctccgggttcaccgcgacgctttcc
aatcaacgggtgcgccaacaactttgcgacgtcggtgcggccatcttcgcggccggcgag
ttggcccccgccgatgccaagctctatgcgttgcgcgacatcaccggcaccgtcgaatcc
ctgccgctgatcgccagttcgatcatgagcaagaagctggccgagggagccggcgcgttg
gtactcgacgtgaaggtcggtgccggggccttcctgaaatccgaggcgcagtcccgcgaa
ctggcgcgcaccatggttgatcttggcgccgcgcatggcgtgccgacgcgcgccctgctg
acggacatgaactcgccgctgggtcgcaccgtgggcaactcgctcgaggtggccgaggcc
ctggaagtgctggccggcggcggaccgctcgacgtcgtggagctgaccgtgcggctggcc
ggcgagatgctgcagctcgccgggatcgaccgccgcgacccggcgcagaccctgcgtgac
ggcagcgcgatggacaggtttcgccggctggtcgacgctcagggcggcgatttgtcgaaa
ccgttgccgattggtcggtgttcggaaaccgtcacggccgaccggagcggcacaatgggc
gacattgacgcgatggcagtgggtttggcggcctggcggctcggcgcgggcagatcccgt
ccgggggcaagggtgcagcacggggcgggggtgcggattcatcgtcgtcccggggagccg
gtggtggccggtgagccgctgttcacgctttacaccgagactcccgaacgcttcggcccg
gcgctggccatgctggacggtggctggagcgtcggggaggccgggccggctccgcggccc
ctgattatcgatcggatcacccgatga

DBGET integrated database retrieval system