KEGG   Mycobacterium kansasii: MKAN_22055Help
Entry
MKAN_22055        CDS       T02887                                 

Definition
monooxygenase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mkn  Mycobacterium kansasii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mkn00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mkn00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mkn00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mkn00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mkn00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mkn00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4842330..4843676)
Genome map
AA seq 448 aa AA seqDB search
MTNPRWIADVVIVGAGFAGLAAARDLAGQGHDVLVFEGRDRVGGRSLTGNVAGLPADMGG
TFVGPTQNQVLALADELRVPTIPTYHDGRNVIHWRGAVRPYRGTIPRLSLAGLLDIARLR
WQFERLARGVPISAPWDAPRAHELDGVSLGQWLRAVRATASSHDLMAIMARVTWGCEPED
VSMLHATRYVRAAGGLDRLLDVENGAQQDRFAGGTQQIADLAAAGLGNRVVLDARVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRAAIEFDPPLPPQYLELTRHWPQGRLSKAYAA
YSTPFWRANGFSGQALSDNGPVFITFDVSPHDDGPGILMGFVDARAFDSLPTEQRRRDTL
RCFASLFGDQALKPLDYADYRWGSEQFAPGGPTAAVPPGSWTKYGRLLREPVGPIHWAGT
ETADEWTGYLEGAVRSGRRAATEVSALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccacgctggattgccgacgtggtcatagtgggtgccggcttcgctggactg
gcggcagcccgcgacctggccggtcagggtcatgacgtgctggtcttcgaaggccgcgac
cgcgtcggcggccgctccctcaccggcaacgtcgcgggattaccggcggatatgggcggc
acgttcgtcggacccactcaaaaccaggtcctggccctggcggacgagctgcgagttccg
accatcccgacctaccacgacggcaggaacgtgatccactggcggggcgcggtgcgcccg
taccgcggcacgatccccaggctttcgctggccggactgctcgacatcgcgcggttgcgc
tggcaattcgagcgactggcccgcggcgtgccgatatccgcgccctgggatgcgccacga
gcgcacgaactcgacggcgtgtcactgggtcagtggttgcgcgcggtgcgcgccaccgcg
tcgtcacacgacctgatggccatcatggcccgggtgacctggggttgcgaacccgaagac
gtgtccatgctgcacgccacccgttatgtacgcgcggcgggcggcctggaccggctcctg
gatgtcgaaaacggcgcccagcaggatcggttcgcgggcggcacgcagcagatcgccgac
ctggcggcggctgggctgggaaaccgggtggtgctggatgcccgggtgcgtcggatcgac
cgccacggcgcgggtgtgaccgtcacgtcggatcagggacaggccgaagccgggttcgtc
atcgtggcgatcccgcccgcacaccgtgcggccatcgagttcgatcccccgctgccgccg
caatacctggaactcacccggcattggccgcagggccggttgagcaaggcctatgccgcg
tattccacaccgttctggcgagccaacggattctccggccaggccttgtccgacaacggc
ccggtgttcatcaccttcgatgtcagcccacatgacgacgggccgggcatcctcatgggt
ttcgtcgatgcccgcgcattcgactccctgcccaccgagcagcgccgccgcgacacgctg
cggtgtttcgcctcgctgttcggcgaccaagcgctcaagccgctcgactacgccgattac
cgttggggcagcgagcaattcgcgccgggcggtcccaccgccgcggtgccgcccggttcc
tggaccaaatacggacggttgctgcgcgaaccggtcgggccgattcactgggccggcacg
gaaaccgcggatgaatggaccggttatttggagggcgccgtcaggtccggtcggcgtgcg
gctaccgaagtctccgcactgctatga

DBGET integrated database retrieval system