KEGG   Mycobacterium kansasii: MKAN_22055Help
Entry
MKAN_22055        CDS       T02887                                 

Definition
monooxygenase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mkn  Mycobacterium kansasii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MKAN_22055
   00330 Arginine and proline metabolism
    MKAN_22055
   00340 Histidine metabolism
    MKAN_22055
   00350 Tyrosine metabolism
    MKAN_22055
   00360 Phenylalanine metabolism
    MKAN_22055
   00380 Tryptophan metabolism
    MKAN_22055
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     MKAN_22055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4842330..4843676)
Genome map
AA seq 448 aa AA seqDB search
MTNPRWIADVVIVGAGFAGLAAARDLAGQGHDVLVFEGRDRVGGRSLTGNVAGLPADMGG
TFVGPTQNQVLALADELRVPTIPTYHDGRNVIHWRGAVRPYRGTIPRLSLAGLLDIARLR
WQFERLARGVPISAPWDAPRAHELDGVSLGQWLRAVRATASSHDLMAIMARVTWGCEPED
VSMLHATRYVRAAGGLDRLLDVENGAQQDRFAGGTQQIADLAAAGLGNRVVLDARVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRAAIEFDPPLPPQYLELTRHWPQGRLSKAYAA
YSTPFWRANGFSGQALSDNGPVFITFDVSPHDDGPGILMGFVDARAFDSLPTEQRRRDTL
RCFASLFGDQALKPLDYADYRWGSEQFAPGGPTAAVPPGSWTKYGRLLREPVGPIHWAGT
ETADEWTGYLEGAVRSGRRAATEVSALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccacgctggattgccgacgtggtcatagtgggtgccggcttcgctggactg
gcggcagcccgcgacctggccggtcagggtcatgacgtgctggtcttcgaaggccgcgac
cgcgtcggcggccgctccctcaccggcaacgtcgcgggattaccggcggatatgggcggc
acgttcgtcggacccactcaaaaccaggtcctggccctggcggacgagctgcgagttccg
accatcccgacctaccacgacggcaggaacgtgatccactggcggggcgcggtgcgcccg
taccgcggcacgatccccaggctttcgctggccggactgctcgacatcgcgcggttgcgc
tggcaattcgagcgactggcccgcggcgtgccgatatccgcgccctgggatgcgccacga
gcgcacgaactcgacggcgtgtcactgggtcagtggttgcgcgcggtgcgcgccaccgcg
tcgtcacacgacctgatggccatcatggcccgggtgacctggggttgcgaacccgaagac
gtgtccatgctgcacgccacccgttatgtacgcgcggcgggcggcctggaccggctcctg
gatgtcgaaaacggcgcccagcaggatcggttcgcgggcggcacgcagcagatcgccgac
ctggcggcggctgggctgggaaaccgggtggtgctggatgcccgggtgcgtcggatcgac
cgccacggcgcgggtgtgaccgtcacgtcggatcagggacaggccgaagccgggttcgtc
atcgtggcgatcccgcccgcacaccgtgcggccatcgagttcgatcccccgctgccgccg
caatacctggaactcacccggcattggccgcagggccggttgagcaaggcctatgccgcg
tattccacaccgttctggcgagccaacggattctccggccaggccttgtccgacaacggc
ccggtgttcatcaccttcgatgtcagcccacatgacgacgggccgggcatcctcatgggt
ttcgtcgatgcccgcgcattcgactccctgcccaccgagcagcgccgccgcgacacgctg
cggtgtttcgcctcgctgttcggcgaccaagcgctcaagccgctcgactacgccgattac
cgttggggcagcgagcaattcgcgccgggcggtcccaccgccgcggtgccgcccggttcc
tggaccaaatacggacggttgctgcgcgaaccggtcgggccgattcactgggccggcacg
gaaaccgcggatgaatggaccggttatttggagggcgccgtcaggtccggtcggcgtgcg
gctaccgaagtctccgcactgctatga

DBGET integrated database retrieval system