KEGG   Mycobacterium kansasii: MKAN_24070Help
Entry
MKAN_24070        CDS       T02887                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mkn  Mycobacterium kansasii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mkn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5318337..5319188
Genome map
AA seq 283 aa AA seqDB search
MPELPEVEVVRRGLAAHVVGKTMTAVRVHHPRAVRRHEAGPADLTARLLGARITGTDRRG
KYLWLTLNSPDSALVVHLGMSGQMLLGVVPRSDHVRISALLDDGTVLSFADQRTFGGWLL
ADLVTVDGSVVPAPVAHLARDPLDPRFDARAVVEVLRGKHSELKRQLLNQEVVSGIGNIY
ADEALWRAKVNGARVAATLTRRQLGAVLDAAAEVMREALAKGGTSFDSLYVNVNGESGYF
DRSLDAYGRDGQNCRRCGAVIRREKFMNRSSFYCPRCQPRPRR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactacctgaggtcgaggtggtgcggcgtggcttggcggcccatgtggtaggc
aagacgatgaccgcggttcgggtccatcacccccgtgcggtacggcgccacgaggccgga
cccgccgacctgacggcgcggctgctgggcgcgcgaattaccggaaccgaccggcgcggc
aagtacttgtggttgacgctgaatagcccggatagcgcacttgtggtgcacctgggcatg
agcgggcagatgttgctgggggtagtgccgcgctccgaccacgtccggatctccgccctg
ctcgacgacgggaccgtgctgagcttcgccgaccagcgcaccttcggcggatggctgctt
gccgacctggtgaccgtggacggcagtgtggtgccggcgccggtcgcccacctggcgcgg
gatccgctcgacccgcggttcgacgcccgtgccgtcgtcgaagtgttgcggggcaagcat
tccgagctcaagcgccagctcctgaaccaagaggtggtctccggaatcggcaatatctac
gccgacgaggcgctgtggcgggccaaggtgaacggcgcccgggtggccgccacgctgacc
cgccggcaactgggcgccgtccttgatgccgccgccgaggtgatgcgggaagcgctggcc
aagggcgggacgtcgttcgattcgctgtatgtcaatgtcaacggcgagtcgggctatttc
gaccgatcgctggacgcctatgggcgcgacggccagaactgccggcgctgcggcgcggtg
attcgccgggagaagttcatgaaccgctcgtcgttctactgtccccgatgccagccgcgg
ccgcggcgttag

DBGET integrated database retrieval system