KEGG   Mycobacterium kansasii: MKAN_26160Help
Entry
MKAN_26160        CDS       T02887                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mkn  Mycobacterium kansasii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MKAN_26160
   00650 Butanoate metabolism
    MKAN_26160
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_26160
   00280 Valine, leucine and isoleucine degradation
    MKAN_26160
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MKAN_26160
Enzymes [BR:mkn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MKAN_26160
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MKAN_26160
Amino acid related enzymes [BR:mkn01007]
 Aminotransferase (transaminase)
  Class III
   MKAN_26160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5742511..5743860)
Genome map
AA seq 449 aa AA seqDB search
MASLEQTRHLVTEIPGPASLELNKRRVAAVSSGVGVMLPVFVVRAGGGILEDADGNRLID
LGSGIAVTTIGNSHPKVVDAVREQVAEFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRS
ALFNSGAEAVENAIKIARAYTRKPAVVAFDHAYHGRTNMTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGELAAARTISVIDKQVGASNLAAVIIEPIQGEGGFIVP
ADGFLPALLDWCRSNDVVFIADEVQTGFARTGAMFACEHEGTDGLEPDLIVTAKGIADGL
PLSAVTGRAEIMDAPHASGVGGTFGGNPVACAAALATIETIEREGLVERARQIEQQIMDR
LLRLQVADDRVGDVRGRGAMIALELVKSGTAEPDAELTEKLATAAHRAGVILLTCGMFGN
VIRLLPPLTITDELLAEGLDIMCGILGDL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgagcagacacgccacctggtcaccgaaatcccgggtcccgcatcgctg
gaactgaacaaacggcgggtcgcggcggtgtccagtggtgtaggggtcatgctgccggtg
ttcgtcgtccgcgccggcggggggatcctcgaggatgccgacgggaaccggctcatcgac
ctgggttccgggatcgccgtgacgaccatcggcaattcccatcccaaggtcgtggacgcg
gtgcgcgagcaggtggcggagttcacccacacctgcttcatggtgacgccctacgagcag
tacgtggccgtcgccgaacaactcaaccggatcaccccgggctccggcgagaagcgctcg
gcgctgttcaactccggcgccgaggccgtcgagaacgccatcaagatcgcccgcgcttac
acccgcaagcccgcggtggtcgcgttcgaccacgcgtatcacggccgcaccaacatgacg
atggcgctgaccgccaagtccatgccctacaagagcggcttcggcccgttcgccccggag
atctaccgggctccgctgtcctacccctaccgcgacggactgctcgacaaggagctggcc
accgacggtgaactggccgccgcacggaccatcagcgtcatcgacaagcaggtcggcgcc
agcaacttggccgccgtcatcatcgagcccatccagggcgaaggcggtttcatcgttccc
gccgacgggttcctgcccgcgctgctggactggtgccgcagcaacgacgtcgtcttcatc
gccgacgaggtgcagaccggctttgcccgcaccggcgcgatgttcgcctgcgagcacgag
ggcaccgacggcctggagcccgacctgatcgtcaccgccaagggcatcgccgacggactg
ccgctgtccgcggtgaccggtcgggccgagatcatggatgcaccgcacgccagcggtgtg
ggcggcacgttcggcggcaacccggtcgcgtgtgcggccgcgctggccaccatcgaaacc
atcgaacgtgagggcctggtggaacgggcccggcagatcgagcagcagatcatggaccgg
ttgttgcggctgcaggtggccgacgaccgagtgggcgacgtgcgtggtcgcggcgccatg
atcgccctcgagctggtgaagtccggaaccgccgaacccgacgccgagctgaccgagaaa
ctggccaccgcagcccaccgcgccggggtgatcctgttgacttgcggcatgttcggcaac
gtcatccggctactgccgccgctgaccatcaccgacgagctactggccgaaggcctcgac
atcatgtgcgggatcctgggcgacctctga

DBGET integrated database retrieval system