KEGG   Mycobacterium kansasii: MKAN_28440Help
Entry
MKAN_28440        CDS       T02887                                 

Definition
SAM-dependent methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mkn  Mycobacterium kansasii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MKAN_28440
Enzymes [BR:mkn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MKAN_28440
Exosome [BR:mkn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MKAN_28440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6284403..6285107)
Genome map
AA seq 234 aa AA seqDB search
MAPGIRNLTRTGQIGDGREAAAVDYVLRYARAGDIDDVLATIDRFAYEKSMLINIGDEKG
PMLDAAARRANPALALELGTYCGYGALRIARAAPAARVYSVELAEANAANARQIWAHAGV
ADRITCVVGTIGDGGHTLDALATEHGFGSGALDFVFIDHDKKVYLDDLQSILDRDWLHPG
SIVVADNVLVPGAPKYRAYMRREQGRLWNTVEHRAHLEYQTLVPDLVLESEYLG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccggaatccgcaacctcaccaggacgggtcaaatcggtgacggtcgcgaagcg
gccgccgtcgactatgtactccggtacgcccgtgccggcgacatcgacgacgtgctggcc
accatcgacaggttcgcctatgaaaagtcgatgctgatcaatatcggcgacgagaagggg
ccgatgctcgacgcggcggcgcggcgcgccaacccggcgctggcgctggagctgggcacc
tactgcggctacggcgcactgcggatcgcccgggcggcgccggcggcccgggtgtactcg
gtcgaactggccgaagccaacgccgccaatgcccggcagatctgggctcatgctggcgtc
gccgaccggataacctgtgtggtcggcaccatcggcgacggcggacacaccctggacgca
ctggcaactgaacacggattcggttctggcgctctggatttcgtgttcatcgaccacgac
aagaaggtctacctggacgacctgcagagtatcctggaccgcgactggctgcatccgggt
tcgatcgtggtagccgacaacgtcctggtgccgggggcgccgaagtaccgcgcctacatg
cggcgcgagcagggcaggctgtggaacaccgtggagcacagggcccacctcgaataccag
accctagtgcccgacctggtactggaatcggagtacctgggttag

DBGET integrated database retrieval system