KEGG   Mycobacterium kansasii 662: LG40_11850Help
Entry
LG40_11850        CDS       T03652                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00071  Fatty acid degradation
mks00072  Synthesis and degradation of ketone bodies
mks00280  Valine, leucine and isoleucine degradation
mks00310  Lysine degradation
mks00362  Benzoate degradation
mks00380  Tryptophan metabolism
mks00620  Pyruvate metabolism
mks00630  Glyoxylate and dicarboxylate metabolism
mks00640  Propanoate metabolism
mks00650  Butanoate metabolism
mks00900  Terpenoid backbone biosynthesis
mks01100  Metabolic pathways
mks01110  Biosynthesis of secondary metabolites
mks01120  Microbial metabolism in diverse environments
mks01130  Biosynthesis of antibiotics
mks01200  Carbon metabolism
mks01212  Fatty acid metabolism
mks02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mks00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG40_11850
   00630 Glyoxylate and dicarboxylate metabolism
    LG40_11850
   00640 Propanoate metabolism
    LG40_11850
   00650 Butanoate metabolism
    LG40_11850
  Lipid metabolism
   00071 Fatty acid degradation
    LG40_11850
   00072 Synthesis and degradation of ketone bodies
    LG40_11850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG40_11850
   00310 Lysine degradation
    LG40_11850
   00380 Tryptophan metabolism
    LG40_11850
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG40_11850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG40_11850
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LG40_11850
Enzymes [BR:mks01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG40_11850
Exosome [BR:mks04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG40_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIR18701
UniProt: X7YM14
Position
complement(2626824..2627972)
Genome map
AA seq 382 aa AA seqDB search
MPEAYVVEAVRTAVGKRNGALAGVHPLDLGAGVFRGLFERVDVDPAAVEDVIVGCVDAVG
GQAGNIGRLAWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMAQTADIIVAGGIQNMS
QIPISSAMEVGKQFGFSSPTAESKGWQHRYGDEEISQFRGAEMIAERWNLSREEMERFAL
SSHEHALSAIRAGHFDNEIVAVGDFRLDEGPRETSLEKMAGLPTLVDGGRLTAALASQIS
DGASAVLLASERAVKDHNLTPRARIHHISARGADPVFMLTGPIPATRYALEKTGLSIDDI
DVVEINEAFAPVVLAWLKEIKADPEKVNPNGGAIALGHPLGATGAKLFTTMLNELERVGG
RYGLQTMCEGGGTANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcgtacgtcgttgaggccgtgcggacagcggtcggcaagcgcaatggagca
ctcgcgggcgtgcatccgctcgacctgggggccggcgtattccgaggcttgttcgagcgc
gtcgacgtcgacccggccgcggtcgaggatgtgatcgtcggttgtgtggacgccgtcggc
ggacaggccggcaacatcggccggctggcgtggctggccgcggggtatccggaagaggtt
ccgggtgtcaccgtcgaccggcaatgcggttccagtcagcaggcgatttcctttggggcg
caagcgattatggcgcagacggccgacatcatcgtggccggcggaatccagaacatgagt
cagatcccgatctcttcggccatggaggtcggcaagcagttcggtttcagctcgccgact
gccgagtcgaaggggtggcagcaccgctacggcgacgaggagatctcgcagttccgcggc
gccgaaatgatcgccgagcggtggaacctgtcccgtgaagagatggagcggttcgcgctc
agcagccacgagcatgcgctatccgcaatcagggcagggcatttcgacaacgagatcgtg
gcggtgggcgacttccgcctcgacgagggacctcgtgagacatcgctggaaaaaatggcc
ggactgccgaccctcgtcgacggcggccggcttaccgccgcgctggccagccagatctcc
gacggcgccagcgcggtgctgctggcgtccgagcgagccgtcaaggaccacaacttgacc
ccgcgggcgcgtattcaccacatcagtgcacgcggtgccgatccggtgttcatgctgaca
ggcccgataccggccacccgctatgcgctggagaagaccgggctttccatcgacgacatc
gacgtcgtggaaatcaacgaggcgttcgcaccggttgtcttggcctggctcaaggaaatc
aaggccgacccggaaaaggtcaatcccaacggcggtgcgatcgcgctgggtcatccgttg
ggagccaccggcgcaaagctgttcaccaccatgctcaacgagctcgagcgcgtcggtggt
cgatatgggttgcagaccatgtgcgagggcggcggcacggctaacgtgacgatcatcgag
cgcctgtag

DBGET integrated database retrieval system