KEGG   Methanocorpusculum labreanum: Mlab_0048Help
Entry
Mlab_0048         CDS       T00472                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_0048
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_0048
   00020 Citrate cycle (TCA cycle)
    Mlab_0048
   00620 Pyruvate metabolism
    Mlab_0048
   00640 Propanoate metabolism
    Mlab_0048
   00650 Butanoate metabolism
    Mlab_0048
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_0048
   00680 Methane metabolism
    Mlab_0048
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_0048
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(49753..50283)
Genome map
AA seq 176 aa AA seqDB search
MYEIRIHSRGGQGGVTAARMMATAAVKDGKFATACPFYGAERRGAPIVSFVRIDDAPVRI
YSQINKPDMIVILDPTVMDTVNVLDGLKEGGSIFINTHDDVDFPAGFKVYKADLTGIALR
ENLVVAGSPIVNTPVIGALAKLGLFSRESGVKAITETFADPRNTAAAKAAYEEVIV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagattcgtattcactcacgcggcggccagggcggagtaacggcggccagaatg
atggccaccgccgccgtgaaagacggaaaattcgcaacggcatgcccgttctacggtgcc
gaacgccgcggcgctccgatcgtttcattcgttcgaatcgacgatgcaccggtgagaatt
tactcccagatcaacaaacccgatatgatcgtcatccttgatccgaccgtcatggacacg
gtaaatgtcttagacggtttgaaagagggagggtcgatcttcatcaacacgcatgacgat
gttgatttccctgcaggcttcaaggtctacaaagcggatcttaccgggatcgcgctccgc
gaaaacctcgtggtcgccggaagtccgatcgtgaacacgccagtgatcggagctctcgca
aaactcggcctcttcagccgggagtcgggagtgaaggcgatcaccgagacgtttgccgat
ccaagaaacactgcggctgcaaaagcggcttatgaggaggtcatcgtatga

DBGET integrated database retrieval system