KEGG   Methanocorpusculum labreanum: Mlab_0049Help
Entry
Mlab_0049         CDS       T00472                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00010  Glycolysis / Gluconeogenesis
mla00020  Citrate cycle (TCA cycle)
mla00620  Pyruvate metabolism
mla00640  Propanoate metabolism
mla00650  Butanoate metabolism
mla00680  Methane metabolism
mla00720  Carbon fixation pathways in prokaryotes
mla01100  Metabolic pathways
mla01120  Microbial metabolism in diverse environments
mla01130  Biosynthesis of antibiotics
mla01200  Carbon metabolism
Module
mla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mla_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_0049
   00020 Citrate cycle (TCA cycle)
    Mlab_0049
   00620 Pyruvate metabolism
    Mlab_0049
   00640 Propanoate metabolism
    Mlab_0049
   00650 Butanoate metabolism
    Mlab_0049
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_0049
   00680 Methane metabolism
    Mlab_0049
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_0049
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABN06227
UniProt: A2SPH1
Position
complement(50284..51408)
Genome map
AA seq 374 aa AA seqDB search
MSELVMSTGNKAVASAVKMAKPLVVAAYPITPQTEIIESIADYVESGDLKARYIPVESEH
SAMTACIGASITGVRVFTATSSHGLLYMHEMLHWAAGARLPIVMGQVNRTLAPGWNIWAE
HTDALSQRDTGWLQVYVSTVQEAYDATLMAFRIAEDNRVLLPVMINMDGFLLSHIMQPFE
MTEPGDFIPPLELPHKIDVNNPKGYGAMSPANVHYQFRFDMEKAMRESRNVIDETEAEFA
KRFGRSYAPVEEYFCDDADVILIAMGTLGKEAEVAVDLLRKEGVKAGVMRIRWFRPFPLN
MNIKGKDLVVIDRDYSFGFGGVVAGEIQARYPDAKIASVIAGLGGQEVTFEDMAEFVRSR
KIGTEYWFGIKEEE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttgtaatgtccaccggtaacaaagccgtagcttcagccgtaaaaatggca
aagccgctcgtcgttgccgcatatcccatcaccccccagaccgagatcatcgaaagcatc
gccgactacgtcgagtccggcgatctcaaagcacgctacatcccggtcgagtcggaacac
tccgccatgaccgcctgtatcggtgcttccatcacgggggtcagagttttcaccgcgaca
agctcacacggtcttctctacatgcatgagatgctccactgggcagcaggcgcacgcctg
ccgatcgtgatggggcaggtcaacagaactcttgctcccggatggaacatctgggcggag
cacacggatgctctttcgcagagggataccggctggcttcaggtctacgtctcgaccgtg
caggaagcatacgacgctaccttgatggcattcaggatcgccgaagacaaccgcgttctt
ctgccggtcatgatcaacatggacggattcctgctctcccacatcatgcagccgttcgag
atgaccgaaccgggagacttcatcccgccgctggaactcccgcataaaatcgatgtcaac
aatccgaaaggctacggcgcaatgagcccggcaaacgtccactaccagttcagattcgac
atggaaaaagccatgcgtgaatcacgaaacgtcatcgacgaaaccgaggcagagtttgca
aaacgcttcggcagaagctatgccccggttgaggaatacttctgcgacgatgctgatgtt
attctcatcgcaatgggaacgctcggcaaagaagccgaggtcgccgttgatctcctgaga
aaagagggagtgaaagccggagtcatgcggatccgctggttcagacccttcccgctgaat
atgaacatcaaaggaaaagacctcgtcgtgatcgaccgtgactactcgttcggcttcggc
ggcgttgttgccggagagatccaggcaagatatccggatgcaaaaatcgcgagcgtcatt
gccggcctcggcggccaggaagttacctttgaagatatggcagagttcgtccgcagccgc
aagatcggaacagaatactggttcggtatcaaggaggaagagtaa

DBGET integrated database retrieval system